y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma13g34430.1
FamilyGT4
Protein PropertiesLength: 338 Molecular Weight: 38093.5 Isoelectric Point: 8.9264
ChromosomeChromosome/Scaffold: 13 Start: 36002357 End: 36006591
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT41423042e-38
  FLSINRFERKKNIQLAISAFAMLNSPEGVLKHKDITNASLTIVGGFDKRLKENVEYLEELKDLAEKEGVSNNIKFITSCSTAERNELLSECLCVLYTPKD
  EHFGIVPLEAMAAYKPVIACNSGGPVESIKNGVTGFLCDPTPLEFSLAMAKLISDPQEADNMG
Full Sequence
Protein Sequence     Length: 338     Download
MLLLSLHPKA IKFMFLLHIM IKTDALRKLL LVPFRLLYQV SVVIPILKIK RSTKVVFYCH    60
FPDLLLAQHS TFIRRMYRKP IDYAEEITTG IADLILVNSK FTASTFANTF KYLDAKGIRP    120
AVLYPAVNVD QFNEPSSFKL NFLSINRFER KKNIQLAISA FAMLNSPEGV LKHKDITNAS    180
LTIVGGFDKR LKENVEYLEE LKDLAEKEGV SNNIKFITSC STAERNELLS ECLCVLYTPK    240
DEHFGIVPLE AMAAYKPVIA CNSGGPVESI KNGVTGFLCD PTPLEFSLAM AKLISDPQEA    300
DNMGREARRH VVESFSTKSF GQHLNRYLVD IHRGKED*                            360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd03798GT1_wlbH_like9.0e-3346324292+
cd03806GT1_ALG11_like1.0e-3392323240+
COG0438RfaG4.0e-3440335300+
cd03801GT1_YqgM_like2.0e-3740316288+
cd03805GT1_ALG2_like8.0e-14039324298+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM26674.1039331109396At1g78800/F9K20_16 [Arabidopsis thaliana]
GenBankACU21459.101833774407unknown [Glycine max]
RefSeqXP_002285480.1039337109408PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002317454.1039337105413predicted protein [Populus trichocarpa]
RefSeqXP_002525620.102533792408alpha-1,3-mannosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2f9f_A3e-1813429913165A Chain A, Crystal Structure Of The Putative Mannosyl Transferase (Wbaz-1)from Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr29a
PDB3c4v_B0.0000000292325165399A Chain A, Crystal Structure Of The Putative Mannosyl Transferase (Wbaz-1)from Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr29a
PDB3c4v_A0.0000000292325165399A Chain A, Crystal Structure Of The Putative Mannosyl Transferase (Wbaz-1)from Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr29a
PDB3c4q_B0.0000000292325165399A Chain A, Structure Of The Retaining Glycosyltransferase Msha : The First Step In Mycothiol Biosynthesis. Organism : Corynebacterium Glutamicum- Complex With Udp
PDB3c4q_A0.0000000292325165399A Chain A, Structure Of The Retaining Glycosyltransferase Msha : The First Step In Mycothiol Biosynthesis. Organism : Corynebacterium Glutamicum- Complex With Udp
Metabolic Pathways
Pathway NameReactionECProtein Name
dolichyl-diphosphooligosaccharide biosynthesisRXN-5462EC-2.4.1.132GDP-Man:Man1GlcNAc2-PP-Dol α-1,3-mannosyltransferase
dolichyl-diphosphooligosaccharide biosynthesisRXN-5463EC-2.4.1.257GDP-Man:Man2GlcNAc2-PP-Dol α-1,6-mannosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EG522343272393090
DR942573272673380
CV290429272593300
EV263639202392400
EV263639392332710.00000000009
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_021_00182.1Aquca_021_00182.2Aquca_021_00182.3
Arabidopsis lyrata477043
Arabidopsis thalianaAT1G78800.1
Brachypodium distachyonBradi5g19840.1
Brassica rapaBra035064
Carica papayaevm.model.supercontig_77.17
Capsella rubellaCarubv10022022m
Chlamydomonas reinhardtiig1920.t1
Citrus clementinaCiclev10022599mCiclev10020399m
Citrus sinensisorange1.1g036860m
Cucumis sativusCucsa.220170.2Cucsa.273740.2Cucsa.273740.1Cucsa.220170.1
Eucalyptus grandisEucgr.F01245.1
Fragaria vescamrna27271.1-v1.0-hybrid
Glycine maxGlyma12g35950.2Glyma12g35950.1Glyma13g34430.2
Gossypium raimondiiGorai.002G054000.2Gorai.002G054000.1
Linum usitatissimumLus10037008Lus10015797
Malus domesticaMDP0000319369MDP0000185482
Manihot esculentacassava4.1_008785m
Medicago truncatulaMedtr1g104880.1
Mimulus guttatusmgv1a007424m
Oryza sativaLOC_Os04g49960.1
Panicum virgatumPavirv00018845mPavirv00056995mPavirv00050038mPavirv00004378m
Physcomitrella patensPp1s246_77V6.1
Phaseolus vulgarisPhvul.005G081600.1
Picea abiesMA_499839g0010
Populus trichocarpaPotri.011G109000.1
Prunus persicappa006490mppa006502m
Ricinus communis29681.m001322
Setaria italicaSi017356mSi013830mSi010219m
Selaginella moellendorffii419620
Sorghum bicolorSb06g026860.1
Thellungiella halophilaThhalv10019736mThhalv10007837m
Vitis viniferaGSVIVT01014186001
Volvox carteriVocar20014584m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny