y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma13g34570.2
FamilyGT22
Protein PropertiesLength: 408 Molecular Weight: 45888.6 Isoelectric Point: 8.4842
ChromosomeChromosome/Scaffold: 13 Start: 36113870 End: 36117602
DescriptionAlg9-like mannosyltransferase family
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT2222880
  LCLTSGCFFASTSFLPSSFSMYAISLASGLFLLDKPAAAISVAVIGVILGWPFSILAFLPVTLYSLSRKFKQAFIAAAVTSILLLALSIVMDFYYYGKWT
  SSVLNLLIYNVAGGGESHLYGTEGPLYYLRNGFNNFNFCFVLALLFLGILPIAKKKYAPDLLIVISPIYIWLGFMSLQPHKEERFLYPVYPLICVAASAV
  IESFPDLFRSKYNPYDRSIIVTVAKVMRPVVLSLILYASHARTFSLINGYSAPLEVYKILEHHDAENNSVLCVGSEWHRFPSSFFIP
Full Sequence
Protein Sequence     Length: 408     Download
MLCLTSGCFF ASTSFLPSSF SMYAISLASG LFLLDKPAAA ISVAVIGVIL GWPFSILAFL    60
PVTLYSLSRK FKQAFIAAAV TSILLLALSI VMDFYYYGKW TSSVLNLLIY NVAGGGESHL    120
YGTEGPLYYL RNGFNNFNFC FVLALLFLGI LPIAKKKYAP DLLIVISPIY IWLGFMSLQP    180
HKEERFLYPV YPLICVAASA VIESFPDLFR SKYNPYDRSI IVTVAKVMRP VVLSLILYAS    240
HARTFSLING YSAPLEVYKI LEHHDAENNS VLCVGSEWHR FPSSFFIPDY VGQVRWIDDG    300
FRGLLPIPFN STLGGTASAP PYFNNKNMAS DKQYLHDVDA CTFLVELQLE RPYLTRGSDL    360
STWEPIAALP YLDRELSPAL YRSFFIPYLW QEKNVFGMYK LLKRRTT*                 420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02816PLN028160.000172193125+
pfam03901Glyco_transf_221.0e-541288315+
Gene Ontology
GO TermDescription
GO:0006506GPI anchor biosynthetic process
GO:0016757transferase activity, transferring glycosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN72375.101404163567hypothetical protein [Vitis vinifera]
EMBLCBI20196.101404106510unnamed protein product [Vitis vinifera]
RefSeqXP_002285438.101404163567PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002316862.101404160563predicted protein [Populus trichocarpa]
RefSeqXP_002523375.101404162566glycosyltransferase, putative [Ricinus communis]
Metabolic Pathways
Pathway NameReactionECProtein Name
dolichyl-diphosphooligosaccharide biosynthesisRXN-5467EC-2.4.1.259Dol-P-Man:Man6GlcNAc2-PP-Dol α-1,2-mannosyltransferase
dolichyl-diphosphooligosaccharide biosynthesisRXN-5469EC-2.4.1.261Dol-P-Man:Man8GlcNAc2-PP-Dol α-1,2-mannosyltransferase
Transmembrane Domains
StartEnd
1534
4160
7597
137154
158175
187209
219241
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO9833272451644080
GT035088335563880
FG8702802271493750
EC3655242941063980
JK7114102511554040
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_021_00239.3Aquca_021_00239.2Aquca_021_00239.1
Arabidopsis lyrata471892
Arabidopsis thalianaAT1G16900.1
Brachypodium distachyonBradi2g06627.1Bradi2g06627.2
Brassica rapaBra016625Bra026017
Carica papayaevm.model.supercontig_97.103
Capsella rubellaCarubv10008988mCarubv10008626m
Citrus clementinaCiclev10019496m
Citrus sinensisorange1.1g009200morange1.1g008307m
Cucumis sativusCucsa.057600.1
Eucalyptus grandisEucgr.F01228.1
Fragaria vescamrna27242.1-v1.0-hybrid
Glycine maxGlyma12g35831.2Glyma12g35831.1Glyma13g34570.1
Gossypium raimondiiGorai.013G173400.1
Linum usitatissimumLus10028153Lus10042853
Malus domesticaMDP0000250399MDP0000193605
Manihot esculentacassava4.1_004544m
Medicago truncatulaMedtr2g076680.1
Mimulus guttatusmgv1a003735m
Oryza sativaLOC_Os01g11070.1
Panicum virgatumPavirv00044939m
Physcomitrella patensPp1s478_15V6.1
Phaseolus vulgarisPhvul.005G066500.1
Picea abiesMA_10429532g0010
Populus trichocarpaPotri.011G110800.1Potri.011G110800.2Potri.011G110800.3
Prunus persicappa003475m
Ricinus communis28842.m000906
Setaria italicaSi000820m
Selaginella moellendorffii442454
Sorghum bicolorSb03g002210.1
Thellungiella halophilaThhalv10007218m
Vitis viniferaGSVIVT01014208001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny