y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma13g41310.1
FamilyAA1
Protein PropertiesLength: 321 Molecular Weight: 35316.9 Isoelectric Point: 7.5957
ChromosomeChromosome/Scaffold: 13 Start: 41647195 End: 41648424
Descriptionlaccase 2
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1803068.39378e-43
  SNNSTLAGILEYDDDNDTPASNRPMLKPTLPDINDTSFVSNLNTKFRSLNSAKHPANVPETVDKSFFFTIGLGSMLCPRNQTCEGPNNRTKFSASMNNIS
  FPLPSVAILEKHFSGQEQDNNGVYYTTDFPVVSLRAFNYTGTPPNNTMVKSGTKVVVIPFNTRVQVVLQDTRCRESSVTSSWVQHVSLGTGWVAIRFLAD
  DPGVWLMHCHIDVHLSWGLRMTWIVND
Full Sequence
Protein Sequence     Length: 321     Download
MLNYACTDTF SLKVKAGKSY LLRLINAAVN TGLFFSIANH IITVFEADAT YIKPFDSDII    60
LIGQGQTTNR GHFSLARAPS NNSTLAGILE YDDDNDTPAS NRPMLKPTLP DINDTSFVSN    120
LNTKFRSLNS AKHPANVPET VDKSFFFTIG LGSMLCPRNQ TCEGPNNRTK FSASMNNISF    180
PLPSVAILEK HFSGQEQDNN GVYYTTDFPV VSLRAFNYTG TPPNNTMVKS GTKVVVIPFN    240
TRVQVVLQDT RCRESSVTSS WVQHVSLGTG WVAIRFLADD PGVWLMHCHI DVHLSWGLRM    300
TWIVNDGKLS HQNEVASSAS *                                              360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02191PLN021915.0e-1712298338+
PLN02604PLN026042.0e-1710302345+
pfam00394Cu-oxidase5.0e-1886962+
TIGR03388ascorbase2.0e-2110298340+
TIGR03389laccase7.0e-1134312364+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN60069.101312199561hypothetical protein [Vitis vinifera]
RefSeqXP_002271047.101312212574PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002278215.101312210572PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002278232.101312209571PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002282815.101312210572PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B0.00000000000410298204517B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1asq_A0.00000000000410298204517B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1asp_B0.00000000000410298204517B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1asp_A0.00000000000410298204517B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1aso_B0.00000000000410298204517B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
Transmembrane Domains
StartEnd
2042
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CT98316726382500
FY43869227312500
JG176300263813090
EW688234253172500
EW68853325712370
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00935.1
Brassica rapaBra005140.269.564Bra005140.269.564
Carica papayaevm.model.supercontig_19.218evm.model.supercontig_139.15.299.495evm.model.supercontig_169.17.281.510evm.model.supercontig_169.17.281.510evm.model.supercontig_139.15.299.495
Citrus sinensisorange1.1g047904morange1.1g008592m.269.548orange1.1g008592m.269.548
Gossypium raimondiiGorai.009G103600.1.261.496Gorai.009G103600.1.261.496
Linum usitatissimumLus10013800Lus10004975
Malus domesticaMDP0000127409
Panicum virgatumPavirv00032912mPavirv00002681mPavirv00055389m
Phaseolus vulgarisPhvul.008G100600.1.286.504Phvul.008G100600.1.286.504
Picea abiesMA_502044g0010MA_9147880g0010MA_115430g0010MA_10430876g0010MA_10053838g0010
MA_9198822g0010MA_14240g0010
Prunus persicappa018465mppa017222mppa022262m
Sorghum bicolorSb03g028920.1
Vitis viniferaGSVIVT01034140001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny