y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma13g42560.1
FamilyGH35
Protein PropertiesLength: 709 Molecular Weight: 80180.6 Isoelectric Point: 7.8979
ChromosomeChromosome/Scaffold: 13 Start: 42511025 End: 42521598
Descriptionbeta-galactosidase 17
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35753990
  FWKDGEPFQIIGGDVHYFRVHPEYWEDRLLKAKALGLNTIQTYVPWNLHEPAPGKLVFEGFANIEAFLNLCHKHGLLVMIRPGPYICGEWDWGGFPGWFY
  SMIPTPKPRSSDPTYLQLVERWWGNLLPKFVPLLYENGGPIIMVQIENEYGSYGDDKEYLHHLITLARGHLGHDVILYTTDGGTRETLEKGTIRGDTIFS
  AVDFGTGEDPWPIFKLQKEFNAPGKSPPLSAEFYTGWLTHWGEKNAQTDADFTAAALEKILQKNGSAVLYMAHGGTNFGFYNGANTGVDEADYKPDLTSY
  DYDAPIRESGDVDNSKFNAIRRVIA
Full Sequence
Protein Sequence     Length: 709     Download
MRIGLKKKKT TSGAASKLLA MAKKLSSKPT ILFIFVSFML FCAFLPVFAP LPSFSSHHSH    60
RNTVNRKFEI ANDRFWKDGE PFQIIGGDVH YFRVHPEYWE DRLLKAKALG LNTIQTYVPW    120
NLHEPAPGKL VFEGFANIEA FLNLCHKHGL LVMIRPGPYI CGEWDWGGFP GWFYSMIPTP    180
KPRSSDPTYL QLVERWWGNL LPKFVPLLYE NGGPIIMVQI ENEYGSYGDD KEYLHHLITL    240
ARGHLGHDVI LYTTDGGTRE TLEKGTIRGD TIFSAVDFGT GEDPWPIFKL QKEFNAPGKS    300
PPLSAEFYTG WLTHWGEKNA QTDADFTAAA LEKILQKNGS AVLYMAHGGT NFGFYNGANT    360
GVDEADYKPD LTSYDYDAPI RESGDVDNSK FNAIRRVIAR YSSVPLPSIP SNNEKARYGP    420
IHLQREAFVF DMFDFTNSTN VFKSETPMSM EYVGQLFGFV LYVTEYKAKR GGRILFIPKL    480
HDRAQVFISC PSEESGARPT YIGTIERWLN NKVTLPDIKC HSKINLFILV ENMGRVNYGS    540
FIFDRKGILS SVYLDKEQVK GWKMFPIPLH NLNEMSTYNP ITQVAYSAFS GISSFRKKLI    600
YKNGNTSKEP AFYSGHFLID KSSQVKDTFI SFNNWGKGIV FVNDFNIGRY WPLRGPQCNL    660
YVPAPLLKQG DNFLVILELE SPDPELVVHT VDEPDFTCGS SGTSLHQL*                720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13364BetaGal_dom4_50.000461267770+
pfam02449Glyco_hydro_428.0e-797230159+
COG1874LacA2.0e-3278386343+
PLN03059PLN030598.0e-4037395379+
pfam01301Glyco_hydro_352.0e-15075401327+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABD28499.102177081492Galactose-binding like [Medicago truncatula]
EMBLCBI35958.10970513707unnamed protein product [Vitis vinifera]
RefSeqNP_565051.106470859697BGAL17 (beta-galactosidase 17); beta-galactosidase/ catalytic/ cation binding [Arabidopsis thaliana]
RefSeqXP_002280228.10217051683PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002327549.10667081643predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3thd_D0617062629A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
PDB3thd_C0617062629A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
PDB3thd_B0617062629A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
PDB3thd_A0617062629A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
PDB3thc_D0617062629A Chain A, Crystal Structure Of Human Beta-Galactosidase In Complex With Galactose
Metabolic Pathways
Pathway NameReactionECProtein Name
lactose degradation IIIBETAGALACTOSID-RXNEC-3.2.1.23β-galactosidase
Transmembrane Domains
StartEnd
3153
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO9796762434677090
EV265836248292760
CX7090152354757090
CX7092992334777090
CO0913062861494340
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_020_00429.1
Arabidopsis lyrata877397
Arabidopsis thalianaAT1G72990.2AT1G72990.1
Brachypodium distachyonBradi2g18440.2Bradi2g18440.3
Brassica rapaBra003861
Carica papayaevm.model.supercontig_1398.1evm.model.supercontig_25.44
Capsella rubellaCarubv10022320m
Citrus clementinaCiclev10024990mCiclev10024996m
Citrus sinensisorange1.1g011205morange1.1g006708morange1.1g006713morange1.1g006715morange1.1g006845m
orange1.1g007259morange1.1g009269morange1.1g011211m
Cucumis sativusCucsa.341150.1
Eucalyptus grandisEucgr.J02679.1Eucgr.J02852.1
Fragaria vescamrna23038.1-v1.0-hybrid
Glycine maxGlyma13g42560.2
Gossypium raimondiiGorai.008G075700.1Gorai.008G075700.2Gorai.009G141300.1Gorai.009G141300.2Gorai.009G141300.3
Linum usitatissimumLus10015616Lus10037634
Malus domesticaMDP0000944874MDP0000921848
Manihot esculentacassava4.1_026281mcassava4.1_034020m
Medicago truncatulaMedtr2g100000.1
Mimulus guttatusmgv1a002369m
Oryza sativaLOC_Os05g46200.2LOC_Os05g46200.1LOC_Os05g46200.3
Panicum virgatumPavirv00010551mPavirv00046579m
Physcomitrella patensPp1s149_266V6.1Pp1s52_244V6.1Pp1s52_244V6.2
Phaseolus vulgarisPhvul.005G158700.1
Picea abiesMA_775331g0010MA_8535581g0010
Populus trichocarpaPotri.003G040000.1Potri.003G037000.1
Prunus persicappa002232m
Ricinus communis28694.m000663.153.29928694.m000663.153.29928694.m000663.62.15328694.m000663.62.153
Setaria italicaSi021395mSi021403m
Selaginella moellendorffii61485
Sorghum bicolorSb09g026870.1
Thellungiella halophilaThhalv10018211m
Vitis viniferaGSVIVT01016865001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny