y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma14g06120.2
FamilyGH85
Protein PropertiesLength: 633 Molecular Weight: 71262.1 Isoelectric Point: 5.641
ChromosomeChromosome/Scaffold: 14 Start: 4416339 End: 4424524
DescriptionGlycosyl hydrolase family 85
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH85703510
  MAGGYLDDKWVQGGTNAEAYAIWHWHLIDVFVYFSHNLVTLPPPSWTNTAHRHGVKVLGTFITEGDEGTTVCNELLSTKESAQMYAKHLAELAVNLGFDG
  WLLNMEVSLKPEQISNLKEFVNHLSLTTHSSVPGSQVIWYDSVTINGDLWWQNELNEHNKPFFDICDGIFTNYSWQEDYPRRSAAVAGDRKFDVYMGIDV
  FGRNTYGGGMWNTNVALDVIRKDDVSAAIFAPGWVYETKQAPDFETAQNRWWSLVEKSWGIVRKYLGTLPFYTNFDQGRGYH
Full Sequence
Protein Sequence     Length: 633     Download
MSHSINSEFK FDPKEPSMPI SYPIKTLKEL ESRSYFESFH YPFNKASVPI ESGYSEPLPN    60
CRRILVCHDM AGGYLDDKWV QGGTNAEAYA IWHWHLIDVF VYFSHNLVTL PPPSWTNTAH    120
RHGVKVLGTF ITEGDEGTTV CNELLSTKES AQMYAKHLAE LAVNLGFDGW LLNMEVSLKP    180
EQISNLKEFV NHLSLTTHSS VPGSQVIWYD SVTINGDLWW QNELNEHNKP FFDICDGIFT    240
NYSWQEDYPR RSAAVAGDRK FDVYMGIDVF GRNTYGGGMW NTNVALDVIR KDDVSAAIFA    300
PGWVYETKQA PDFETAQNRW WSLVEKSWGI VRKYLGTLPF YTNFDQGRGY HISVDGDQVS    360
DATWCNISSQ GVQPLLEFAD STANSIQPLV DLKEASYSGG GNITFKGSLE KDNYLKRRIF    420
QGEFTLSELP IHFFYSVKSD SNSSLGLVLE FTSTINKAMS ILLTSHGMDH LSSGFSKVVP    480
TSEHKGNAPG WVIHEVLGHI TVKTSNYKPD FPVSTSWLVD GEYINWKSGP QDSRILSVKI    540
SWELKEGKNF AFPHYNVYVE KIPKLAGGNS GTTIEHVQEY LGVAHVNCFY VSELKVPASI    600
SNLKFIIQVC SFDGTNQNLE DCPYYQLEIK GL*                                 660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02874GH18_CFLE_spore_hydrolase0.00395198112+
cd00598GH18_chitinase-like8.0e-670221164+
COG4724COG47241.0e-4081487441+
pfam03644Glyco_hydro_859.0e-12370354304+
cd06547GH85_ENGase3.0e-13465379335+
Gene Ontology
GO TermDescription
GO:0005737cytoplasm
GO:0033925mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002273683.101163116689PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002315137.101763126698predicted protein [Populus trichocarpa]
RefSeqXP_002315138.10263112695predicted protein [Populus trichocarpa]
RefSeqXP_002520781.101163119692endo beta n-acetylglucosaminidase, putative [Ricinus communis]
RefSeqXP_002520784.101163117686endo beta n-acetylglucosaminidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3fhq_F7e-284245028465A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fhq_D7e-284245028465A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fhq_B7e-284245028465A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fhq_A7e-284245028465A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fha_D1e-274245028465A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DB96895520212020
BU7621602044186210
GR107739245643080
EL437937257893450
DW1686552541864380
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00225.1
Arabidopsis lyrata497439.76.201497439.76.201872478497439.204.302487338
497439.204.302
Arabidopsis thalianaAT5G05460.1AT3G11040.1
Brachypodium distachyonBradi1g14127.1
Brassica rapaBra034160Bra005854
Carica papayaevm.model.supercontig_19.130
Capsella rubellaCarubv10000369mCarubv10013078m
Chlamydomonas reinhardtiiCre13.g582250.t1.2
Citrus clementinaCiclev10031026m.70.259Ciclev10031026m.70.259Ciclev10030777m
Cucumis sativusCucsa.144380.1Cucsa.144370.1
Eucalyptus grandisEucgr.J00174.1
Fragaria vescamrna21040.1-v1.0-hybrid
Glycine maxGlyma18g40011.1Glyma02g43025.1Glyma11g35630.1Glyma14g06130.1Glyma14g06120.1
Glyma18g02770.1Glyma02g43020.2
Gossypium raimondiiGorai.012G079500.1Gorai.011G290600.1
Linum usitatissimumLus10017430Lus10007526
Manihot esculentacassava4.1_029708mcassava4.1_031267m
Medicago truncatulaMedtr3g071610.1
Mimulus guttatusmgv1a002327mmgv1a001722m
Oryza sativaLOC_Os05g27960.1
Physcomitrella patensPp1s13_33V6.2Pp1s13_33V6.1
Phaseolus vulgarisPhvul.001G245900.1
Picea abiesMA_10436931g0010MA_10435721g0010
Populus trichocarpaPotri.008G073000.1Potri.010G184300.1Potri.010G184300.2Potri.010G184200.1Potri.010G184200.2
Prunus persicappa015834m
Ricinus communis29729.m00228229729.m002279
Setaria italicaSi021368m
Selaginella moellendorffii61572
Sorghum bicolorSb09g016230.1
Thellungiella halophilaThhalv10012879mThhalv10020200m
Vitis viniferaGSVIVT01032751001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny