y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma14g06130.1
FamilyGH85
Protein PropertiesLength: 702 Molecular Weight: 79084.5 Isoelectric Point: 7.2062
ChromosomeChromosome/Scaffold: 14 Start: 4428942 End: 4437229
DescriptionGlycosyl hydrolase family 85
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH85703510
  MAGGYLDDKWVQGGTNAEAYAIWHWHLIDVFVYFSHNLVTLPPPSWTNTAHRHGVKVLGTFITEWNEGKAACDKLLSTKESAQMYAKHLAELAANLGFDG
  WLLNIEVTLKPEQISNLKEFVNHLSLTMHSSVTGSLVIWYDSVTINGDLWWQNELNEYNKSFFDICDGIFTNYSWQEDYPWRSASVAGDRKFDVYMGIDV
  FGRGTYGGGQWNTNVALDVIRKADVSAAIFAPGWVYETKQAPDFKTAQNRWWGLVEKSWGIVRKYHGTLPFYTNFDQGHGYH
Full Sequence
Protein Sequence     Length: 702     Download
MSHSINSEFK FDPKEPSMPI SYPIKTLKEL ESRSYFESFH YPFNKASVPI ESGYSEPLPN    60
RRRILVCHDM AGGYLDDKWV QGGTNAEAYA IWHWHLIDVF VYFSHNLVTL PPPSWTNTAH    120
RHGVKVLGTF ITEWNEGKAA CDKLLSTKES AQMYAKHLAE LAANLGFDGW LLNIEVTLKP    180
EQISNLKEFV NHLSLTMHSS VTGSLVIWYD SVTINGDLWW QNELNEYNKS FFDICDGIFT    240
NYSWQEDYPW RSASVAGDRK FDVYMGIDVF GRGTYGGGQW NTNVALDVIR KADVSAAIFA    300
PGWVYETKQA PDFKTAQNRW WGLVEKSWGI VRKYHGTLPF YTNFDQGHGY HISVDGDQVS    360
DATWCNISSQ SIQPLLEFAD STANSIQLIV DLKEASYSGG GNITFKGSLG EGTYLKRRIF    420
QGQSILAKLP IHFIYSVKSD SNSSLGLVLD FTSTINKTTP VLLTSHGMDH LSSEFSKVVL    480
TSEHKGNAPG WVIHEGTIEM NGYILTGIHA LCYRPNAPSM KSRPFGPDHA VPSSTDYFAV    540
LGHITVKTSN YKPDFPVSTS WLVNGECINW KSGPQDSRIL SVKISWKLKN GQNLAFSHHN    600
VYVEKPPKLA YGNPSTTLEP VQEYLGVAHV NCFYVSELKV PASTSSLKFI IQVCGFDGTN    660
QNLAKSPRYQ LEIKDHKLSF MKYLSYIYIW ISHWMRFLSS K*                       720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02874GH18_CFLE_spore_hydrolase0.000895198112+
cd00598GH18_chitinase-like1.0e-570193136+
COG4724COG47243.0e-4143487483+
pfam03644Glyco_hydro_853.0e-12370354304+
cd06547GH85_ENGase4.0e-13665379335+
Gene Ontology
GO TermDescription
GO:0005737cytoplasm
GO:0033925mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002273683.101167416688PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002315137.101767426697predicted protein [Populus trichocarpa]
RefSeqXP_002315138.10267412694predicted protein [Populus trichocarpa]
RefSeqXP_002520781.101167419691endo beta n-acetylglucosaminidase, putative [Ricinus communis]
RefSeqXP_002520784.101167417685endo beta n-acetylglucosaminidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3fhq_F6e-304245028465A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fhq_D6e-304245028465A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fhq_B6e-304245028465A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fhq_A6e-304245028465A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
PDB3fha_D7e-304245028465A Chain A, Structure Of Endo-Beta-N-Acetylglucosaminidase A
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EV2685082424196580
GR107739245643080
EL437937257893450
GW895450230152440
JG6212242791153920
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00225.1
Arabidopsis lyrata497439.76.201497439.76.201872478497439.204.302487338
497439.204.302
Arabidopsis thalianaAT5G05460.1AT3G11040.1
Brachypodium distachyonBradi1g14127.1
Brassica rapaBra034160Bra005854
Carica papayaevm.model.supercontig_19.130
Capsella rubellaCarubv10000369mCarubv10013078m
Chlamydomonas reinhardtiiCre13.g582250.t1.2
Citrus clementinaCiclev10031026m.70.259Ciclev10031026m.70.259Ciclev10030777m
Cucumis sativusCucsa.144380.1Cucsa.144370.1
Eucalyptus grandisEucgr.J00174.1
Fragaria vescamrna21040.1-v1.0-hybrid
Glycine maxGlyma14g06120.2Glyma18g40011.1Glyma02g43025.1Glyma11g35630.1Glyma14g06120.1
Glyma18g02770.1Glyma02g43020.2
Gossypium raimondiiGorai.012G079500.1Gorai.011G290600.1
Linum usitatissimumLus10017430Lus10007526
Manihot esculentacassava4.1_029708mcassava4.1_031267m
Medicago truncatulaMedtr3g071610.1
Mimulus guttatusmgv1a002327mmgv1a001722m
Oryza sativaLOC_Os05g27960.1
Physcomitrella patensPp1s13_33V6.2Pp1s13_33V6.1
Phaseolus vulgarisPhvul.001G245900.1
Picea abiesMA_10436931g0010MA_10435721g0010
Populus trichocarpaPotri.008G073000.1Potri.010G184300.1Potri.010G184300.2Potri.010G184200.1Potri.010G184200.2
Prunus persicappa015834m
Ricinus communis29729.m00228229729.m002279
Setaria italicaSi021368m
Selaginella moellendorffii61572
Sorghum bicolorSb09g016230.1
Thellungiella halophilaThhalv10012879mThhalv10020200m
Vitis viniferaGSVIVT01032751001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny