y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma14g23621.1
FamilyGH28
Protein PropertiesLength: 227 Molecular Weight: 25301.7 Isoelectric Point: 9.7529
ChromosomeChromosome/Scaffold: 14 Start: 28042823 End: 28044009
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH281322224.3e-30
  DGSKEVTILNVTCEPRHGISVGSLGKYSNEESVEDLTIKNCTLKNTNNGLRIKTWPSTPITSLVPNLHFEDIIMINVNNPIIIGQEYCPWN
Full Sequence
Protein Sequence     Length: 227     Download
MKMVFPHSMV TIALVLMLAS YVKAHVGLFD IRKYGAIPNG DTTMDLQNAW RDACVSMTPS    60
KVVVPSGKYK LRQIDFMGLI KLILRIRFGY INFLTLFGNG TFHGQGKMAW KQNNCAKNKN    120
CKKLAMKINS SDGSKEVTIL NVTCEPRHGI SVGSLGKYSN EESVEDLTIK NCTLKNTNNG    180
LRIKTWPSTP ITSLVPNLHF EDIIMINVNN PIIIGQEYCP WNQCSI*                  240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00295Glyco_hydro_280.00354176145+
PLN02188PLN021883.0e-1123110110+
PLN02793PLN027936.0e-1413421986+
PLN02188PLN021887.0e-2312822497+
pfam00295Glyco_hydro_289.0e-2513222493+
Gene Ontology
GO TermDescription
GO:0004650polygalacturonase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABN08387.1092145277Pectolytic enzyme, Pectin lyase fold [Medicago truncatula]
EMBLCAA72003.12e-39114225212317polygalacturonase [Medicago sativa]
EMBLCAN65674.11e-3948224671904hypothetical protein [Vitis vinifera]
EMBLCAN65674.11e-2612822610841181hypothetical protein [Vitis vinifera]
EMBLCBI22049.102822627259unnamed protein product [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2iq7_G0.000006126218179266A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
PDB2iq7_F0.000006126218179266A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
PDB2iq7_E0.000006126218179266A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
PDB2iq7_D0.000006126218179266A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
PDB2iq7_C0.000006126218179266A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2103EC-3.2.1.15polygalacturonase
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CN496790991282269e-30
CO417950991282269e-30
CN491697991282261e-29
GO513613991282261e-29
GO028956941322252e-29
Orthologous Group
SpeciesID
Citrus sinensisorange1.1g047946m
Malus domesticaMDP0000284808
Populus trichocarpaPotri.012G013600.1
Prunus persicappa012438mppa026186m
Vitis viniferaGSVIVT01020328001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny