y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma14g38290.1
FamilyGT47
Protein PropertiesLength: 441 Molecular Weight: 50748.3 Isoelectric Point: 9.4727
ChromosomeChromosome/Scaffold: 14 Start: 47448479 End: 47452118
DescriptionExostosin family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT47663630
  SLKIYVYQEDEIDGLKELLRGRDAKITDEACLKGQWGSQVKIHKLLLQSKQRTWKKEEADLFFVPSYVKCARMMGGLNDKEINSTYVKVISQMPYFRLSG
  GRNHIFVFPSGAGAHLFKSWATYINRSIILTPEGDRTDKRDTSAFNTWKDIIIPGNIDDGMTKTGDTTVQPLPLSKRKYLANYLGRAQGKAGRLKLIELS
  KQFPEKLECPDLKFSGPDKLGRKEYFEHLRNSKFCLAPRGESSWTLRFYESFFVECVPVILSDQIELPFQNVIDYSQISIKWPSSQIGPELLQYLESI
Full Sequence
Protein Sequence     Length: 441     Download
MSASNKWRAM SHHQHQPLCT RTHQIGALLL VATTFFFTRM LSTSTLSTSV VHVSQPRFQW    60
GQSQLSLKIY VYQEDEIDGL KELLRGRDAK ITDEACLKGQ WGSQVKIHKL LLQSKQRTWK    120
KEEADLFFVP SYVKCARMMG GLNDKEINST YVKVISQMPY FRLSGGRNHI FVFPSGAGAH    180
LFKSWATYIN RSIILTPEGD RTDKRDTSAF NTWKDIIIPG NIDDGMTKTG DTTVQPLPLS    240
KRKYLANYLG RAQGKAGRLK LIELSKQFPE KLECPDLKFS GPDKLGRKEY FEHLRNSKFC    300
LAPRGESSWT LRFYESFFVE CVPVILSDQI ELPFQNVIDY SQISIKWPSS QIGPELLQYL    360
ESIPDEEIEK IIARGRQVRC WWVYASDSES CSAMRGIMWE LQRKVRQFHH SAETFWLHNG    420
SIVNRNLVEF PKWELPVPLP *                                              480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03016Exostosin4.0e-4567363306+
Gene Ontology
GO TermDescription
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_564141.1034405462exostosin family protein [Arabidopsis thaliana]
RefSeqXP_002265632.1024403459PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002300942.1024403460predicted protein [Populus trichocarpa]
RefSeqXP_002307477.101144014460predicted protein [Populus trichocarpa]
RefSeqXP_002526175.101044016453catalytic, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FE7079142791073850
FE7079132741684410
HO781282307183240
CX6688322911274170
HO781282473173631e-16
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00344.3Aquca_014_00344.1Aquca_014_00344.2
Arabidopsis lyrata472383
Arabidopsis thalianaAT1G21480.2AT1G21480.1
Brachypodium distachyonBradi5g20997.1
Brassica rapaBra016420Bra017918
Carica papayaevm.model.supercontig_49.73
Capsella rubellaCarubv10009077m
Citrus clementinaCiclev10001673mCiclev10002072mCiclev10001104mCiclev10001922m
Cucumis sativusCucsa.077120.2Cucsa.077120.1
Eucalyptus grandisEucgr.E02380.2Eucgr.E02380.1
Fragaria vescamrna00939.1-v1.0-hybrid
Gossypium raimondiiGorai.005G082700.1Gorai.005G082700.6Gorai.005G082700.3Gorai.005G082700.2Gorai.005G082700.4
Gorai.005G082700.5
Linum usitatissimumLus10028632Lus10018930
Malus domesticaMDP0000251576MDP0000259719
Manihot esculentacassava4.1_011268mcassava4.1_012629m
Mimulus guttatusmgv1a006022m
Panicum virgatumPavirv00023264mPavirv00031056m
Physcomitrella patensPp1s48_252V6.1
Phaseolus vulgarisPhvul.001G063800.1
Populus trichocarpaPotri.002G072300.1Potri.005G187400.3Potri.005G187400.2Potri.005G187400.1
Prunus persicappa005428m
Ricinus communis27985.m000889
Setaria italicaSi002210mSi002276mSi001530m
Selaginella moellendorffii104774
Sorghum bicolorSb03g040220.1
Thellungiella halophilaThhalv10007584m
Vitis viniferaGSVIVT01010019001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny