y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma14g39880.1
FamilyAA1
Protein PropertiesLength: 548 Molecular Weight: 60830.8 Isoelectric Point: 9.206
ChromosomeChromosome/Scaffold: 14 Start: 48951994 End: 48956929
DescriptionSKU5 similar 5
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1455020
  YPLGVRQQGILINGQFPGPDIHSVTNDNLIINVFNSLDQPFLLSWNGVQQRRNSFEDGVLGTTCPIPPGGNFTYILQVKDQIGSFYYFPSLAFHKAAGGF
  GGIRILSRPRIPVPFDDPAGDYTVLIGDWYKLNHTDLMSLLDSGRKLPFPNGILINGRGSNGAYFNVEQGKTYRLRISNVGLENSLNFRIQNHKLKLVEV
  EGTHTLQTTYSSLDVHVGQSYSVLVTADQPAQDYYIVVSTRFTSTVLTSTGVLRYSNSAGPVSGPPPGGPTIQIDWSLNQARSIRTNLTASGPRPNPQGS
  YHYGLINTTRTIILSSSPGIVNGKQRYAINSVSYVAPDTPLKLADYFKIPGVFRVGSFSDRPTGGGIYLDTSVLQTDYRTFVEFVFQNDEDIIQSYHLDG
  YSFFVVGMDGGQWTPASRNTYNLRDAVSRCTTQVYPKSWTAIYIALDNVGMWNLRSEF
Full Sequence
Protein Sequence     Length: 548     Download
MRAKMTLKTA AVAVAIVCIS AFSITVVAED PYRFFNWNVT YGDIYPLGVR QQGILINGQF    60
PGPDIHSVTN DNLIINVFNS LDQPFLLSWN GVQQRRNSFE DGVLGTTCPI PPGGNFTYIL    120
QVKDQIGSFY YFPSLAFHKA AGGFGGIRIL SRPRIPVPFD DPAGDYTVLI GDWYKLNHTD    180
LMSLLDSGRK LPFPNGILIN GRGSNGAYFN VEQGKTYRLR ISNVGLENSL NFRIQNHKLK    240
LVEVEGTHTL QTTYSSLDVH VGQSYSVLVT ADQPAQDYYI VVSTRFTSTV LTSTGVLRYS    300
NSAGPVSGPP PGGPTIQIDW SLNQARSIRT NLTASGPRPN PQGSYHYGLI NTTRTIILSS    360
SPGIVNGKQR YAINSVSYVA PDTPLKLADY FKIPGVFRVG SFSDRPTGGG IYLDTSVLQT    420
DYRTFVEFVF QNDEDIIQSY HLDGYSFFVV GMDGGQWTPA SRNTYNLRDA VSRCTTQVYP    480
KSWTAIYIAL DNVGMWNLRS EFWARQYLGQ QFYMRVYTTS TSIRDEYPVP KNALLCGRAS    540
GRHTRPL*                                                             600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02991PLN02991026544519+
PLN02792PLN02792026544522+
PLN02835PLN02835026544519+
PLN02354PLN02354026541524+
PLN02168PLN02168026540531+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACJ85585.1055471544unknown [Medicago truncatula]
RefSeqNP_177743.1095474541sks5 (SKU5 Similar 5); copper ion binding / oxidoreductase [Arabidopsis thaliana]
RefSeqXP_002300669.101154710547multicopper oxidase [Populus trichocarpa]
RefSeqXP_002307765.101154710548predicted protein [Populus trichocarpa]
RefSeqXP_002510630.1055473546multicopper oxidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1asq_B0335374539A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1asq_A0335374539A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1asp_B0335374539A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1asp_A0335374539A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1aso_B0335374539A Chain A, Arabidopsis Thaliana Peroxidase N
Transmembrane Domains
StartEnd
729
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY262568345644080
HO8017254401065430
JG0725093271154410
JK9880933002175160
DT473537279253030
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_033_00145.1Aquca_043_00093.1Aquca_007_00456.1Aquca_007_00455.1Aquca_010_00308.1
Aquca_007_00844.1Aquca_013_00695.2Aquca_013_00695.1Aquca_085_00021.1Aquca_007_00455.2
Aquca_033_00145.2Aquca_003_00198.1Aquca_007_00844.2Aquca_003_00196.1Aquca_003_00195.2
Aquca_003_00195.1Aquca_013_00695.3Aquca_013_00695.5Aquca_013_00695.4Aquca_108_00035.1
Aquca_007_00844.3Aquca_108_00035.2Aquca_013_00695.6Aquca_108_00035.3Aquca_001_00552.1
Aquca_030_00015.1Aquca_019_00187.1Aquca_003_00195.3Aquca_007_00844.5Aquca_007_00844.4
Arabidopsis lyrata914433895494475543313077328883
886966911635490604476726884826
490933918182320180478720892557
492307478721474617
Arabidopsis thalianaAT4G22010.1AT1G21850.1AT1G21860.1AT1G41830.1AT1G76160.1
AT5G66920.1AT4G12420.2AT4G12420.1AT4G28090.1AT4G38420.1
AT1G75790.1AT5G48450.1AT4G37160.1AT5G51480.1AT3G13390.1
AT1G55570.1AT2G23630.1AT3G13400.1AT4G25240.1AT1G55560.1
Brachypodium distachyonBradi1g26470.1Bradi1g32470.1Bradi3g16940.1Bradi5g18317.1Bradi1g52200.1
Bradi3g11540.1Bradi2g03777.1Bradi2g53297.1Bradi2g22000.1Bradi1g58840.1
Brassica rapaBra015781Bra013582Bra034943Bra037137Bra012117
Bra025818Bra036800Bra008241Bra018479Bra000773
Bra032154Bra033564Bra017796Bra022551Bra008223
Bra022513Bra001503Bra029171Bra001504Bra034679
Bra020700Bra011721Bra002825Bra013877Bra039388
Bra038001Bra039389Bra028255Bra030850Bra034680
Carica papayaevm.model.supercontig_87.90evm.model.supercontig_6.404evm.model.supercontig_26.234evm.model.supercontig_29.122evm.model.supercontig_6.405
evm.model.supercontig_20.137evm.model.supercontig_119.3evm.model.supercontig_3.312evm.model.supercontig_53.162evm.TU.contig_43054.1
evm.model.supercontig_340.9
Capsella rubellaCarubv10004445mCarubv10020107mCarubv10008790mCarubv10010844mCarubv10000546m
Carubv10004509mCarubv10026189mCarubv10007118mCarubv10021484mCarubv10006539m
Carubv10025315mCarubv10012235mCarubv10015454mCarubv10004433mCarubv10012595m
Carubv10016186mCarubv10026290mCarubv10026165m
Citrus clementinaCiclev10014842mCiclev10025326mCiclev10028140mCiclev10014825mCiclev10000783m
Ciclev10019410mCiclev10027285mCiclev10014680mCiclev10018007mCiclev10001156m
Ciclev10033418mCiclev10004595mCiclev10004913mCiclev10033561m
Citrus sinensisorange1.1g009283morange1.1g009242morange1.1g009054morange1.1g009127morange1.1g009149m
orange1.1g011178morange1.1g007735morange1.1g012024morange1.1g009171morange1.1g007633m
orange1.1g046746morange1.1g010700morange1.1g009960morange1.1g007635morange1.1g012225m
orange1.1g012003morange1.1g042677morange1.1g015447morange1.1g020366m
Cucumis sativusCucsa.148590.1Cucsa.085720.1Cucsa.099250.1Cucsa.102200.1Cucsa.394150.1
Cucsa.271930.1Cucsa.112290.1Cucsa.152590.1Cucsa.152620.1Cucsa.152630.1
Cucsa.302090.1Cucsa.166260.1Cucsa.251640.1Cucsa.366770.1Cucsa.102200.2
Cucsa.388290.1Cucsa.271930.2Cucsa.152610.1Cucsa.166260.2Cucsa.308750.1
Eucalyptus grandisEucgr.I01478.1Eucgr.A01118.1Eucgr.H01991.1Eucgr.I00988.3Eucgr.I00988.2
Eucgr.I00988.1Eucgr.F03538.1Eucgr.F01712.1Eucgr.F01712.2Eucgr.D01344.1
Eucgr.I00990.1Eucgr.B03581.1Eucgr.F03538.2Eucgr.K00156.1Eucgr.E00461.1
Eucgr.I01478.2Eucgr.J01719.1Eucgr.G02744.1Eucgr.B03580.1Eucgr.J01720.1
Eucgr.H00721.1Eucgr.J01040.1
Fragaria vescamrna23952.1-v1.0-hybridmrna08608.1-v1.0-hybridmrna17174.1-v1.0-hybridmrna32248.1-v1.0-hybridmrna19640.1-v1.0-hybrid
mrna29389.1-v1.0-hybridmrna17390.1-v1.0-hybridmrna29390.1-v1.0-hybridmrna23416.1-v1.0-hybridmrna18269.1-v1.0-hybrid
mrna21247.1-v1.0-hybridmrna01568.1-v1.0-hybridmrna23418.1-v1.0-hybrid
Glycine maxGlyma06g46350.1Glyma12g31920.1Glyma11g06290.3Glyma11g06290.2Glyma11g06290.1
Glyma01g38980.1Glyma11g10320.1Glyma12g10420.1Glyma12g02610.1Glyma17g01580.1
Glyma17g38120.1Glyma04g02140.1Glyma14g39880.3Glyma06g02240.1Glyma14g39880.2
Glyma07g39160.1Glyma17g21490.1Glyma17g21530.1Glyma11g36390.1Glyma07g39160.2
Glyma06g47670.1Glyma04g13670.1Glyma06g46350.2Glyma17g14730.1Glyma08g45730.1
Glyma20g03030.1Glyma05g04270.1Glyma05g17432.1Glyma07g35170.1Glyma20g33460.1
Glyma20g33470.2Glyma10g34110.2Glyma09g24590.1Glyma07g35180.1Glyma09g24590.2
Glyma13g09707.1Glyma11g06290.5Glyma11g06290.4Glyma05g17404.1Glyma19g07512.1
Glyma15g11570.1
Gossypium raimondiiGorai.008G038600.1Gorai.002G202300.1Gorai.008G189200.1Gorai.009G179300.1Gorai.009G189900.1
Gorai.010G181000.1Gorai.009G268100.1Gorai.007G052900.1Gorai.002G120000.1Gorai.007G209900.2
Gorai.007G209900.1Gorai.008G038600.2Gorai.009G189900.2Gorai.008G073000.1Gorai.008G236600.2
Gorai.008G236600.1Gorai.009G268100.2Gorai.010G181000.2Gorai.002G202300.2Gorai.008G038600.4
Gorai.008G038600.3Gorai.006G212500.5Gorai.006G212500.3Gorai.006G212500.2Gorai.011G104400.1
Gorai.001G102100.1Gorai.001G048300.1Gorai.006G212500.1Gorai.009G189900.3Gorai.006G212500.4
Gorai.007G052900.2Gorai.007G209700.1Gorai.009G194300.1Gorai.013G245000.2Gorai.013G245000.1
Gorai.013G244800.1Gorai.002G173600.1Gorai.009G309400.1Gorai.006G212500.7Gorai.006G212500.6
Gorai.006G212500.8Gorai.009G309500.1Gorai.013G244900.1Gorai.004G098200.1Gorai.004G016000.1
Gorai.013G244700.1Gorai.007G052900.3Gorai.008G038600.5Gorai.008G038600.6Gorai.006G269000.1
Gorai.010G181000.3
Linum usitatissimumLus10030045Lus10035282Lus10022465Lus10016770Lus10020022
Lus10005649Lus10015545Lus10034560Lus10032241Lus10021238
Lus10021832Lus10028921Lus10004339Lus10022648Lus10024604
Lus10000837Lus10019642Lus10031143Lus10023977.45.501Lus10031722
Lus10025860Lus10038239Lus10010338Lus10038920Lus10021864
Lus10027207Lus10037941Lus10023539Lus10036492Lus10010358
Lus10010337Lus10021863Lus10025107Lus10040424Lus10017262
Lus10003346Lus10013556
Malus domesticaMDP0000185635MDP0000150489MDP0000610961MDP0000283457MDP0000306888
MDP0000221906MDP0000214159MDP0000522743MDP0000133475MDP0000266398
MDP0000459304MDP0000120008MDP0000436308MDP0000185799MDP0000261928
MDP0000246398MDP0000226700MDP0000197717MDP0000436303MDP0000261927
MDP0000313123MDP0000296578MDP0000319147MDP0000279478MDP0000275020
MDP0000054764MDP0000198994MDP0000258905MDP0000288520MDP0000279576
MDP0000138735
Manihot esculentacassava4.1_005161mcassava4.1_005089mcassava4.1_004981mcassava4.1_004947mcassava4.1_005181m
cassava4.1_005167mcassava4.1_024295mcassava4.1_004151mcassava4.1_004070mcassava4.1_021221m
cassava4.1_031703mcassava4.1_004165mcassava4.1_023993mcassava4.1_004748mcassava4.1_004139m
cassava4.1_004463mcassava4.1_028327mcassava4.1_027139mcassava4.1_029605mcassava4.1_004448m
Medicago truncatulaMedtr4g049390.1Medtr2g088080.1Medtr4g132320.1Medtr5g018270.1Medtr4g101650.1
Medtr2g088080.2Medtr3g008580.1Medtr4g083190.1Medtr7g051440.1Medtr3g083450.1
Medtr3g083440.1Medtr3g083390.1Medtr3g083400.1Medtr3g083430.1Medtr3g083410.1
Medtr4g083210.1
Mimulus guttatusmgv1a004187mmgv1a004185mmgv11b015886mmgv1a004001mmgv1a003982m
mgv1a003271mmgv1a004238mmgv1a004264mmgv1a003515mmgv1a003381m
mgv1a003243mmgv1a004531mmgv1a019613mmgv1a003925mmgv1a003980m
mgv1a003910mmgv1a002399mmgv1a003754mmgv1a026945mmgv1a025826m
Oryza sativaLOC_Os06g46500.1LOC_Os04g47400.1LOC_Os07g32660.1LOC_Os06g01490.1LOC_Os08g05820.1
LOC_Os01g01030.1LOC_Os07g02810.1LOC_Os01g60080.1LOC_Os05g40740.3LOC_Os05g40740.2
LOC_Os05g40740.1LOC_Os05g40740.4LOC_Os10g36390.1.60.303LOC_Os10g36390.1.60.303LOC_Os10g36390.1.306.495
LOC_Os10g36390.1.306.495
Panicum virgatumPavirv00030159mPavirv00043865mPavirv00039677mPavirv00007977mPavirv00030616m
Pavirv00037469mPavirv00038528mPavirv00056216mPavirv00061179mPavirv00035819m
Pavirv00060782mPavirv00012178mPavirv00055525mPavirv00050446mPavirv00015689m
Pavirv00052022mPavirv00002522mPavirv00069222mPavirv00062572mPavirv00011924m
Pavirv00039678mPavirv00004591mPavirv00034598m
Physcomitrella patensPp1s217_57V6.1Pp1s136_116V6.1
Phaseolus vulgarisPhvul.002G021900.1Phvul.011G025400.1Phvul.011G102500.1Phvul.009G021000.1Phvul.001G001500.1
Phvul.003G080100.1Phvul.003G247700.1Phvul.003G247800.1Phvul.001G269100.1Phvul.003G217800.1
Phvul.005G008000.1Phvul.008G134900.1Phvul.002G101700.1Phvul.002G101800.1Phvul.001G269200.1
Phvul.007G140000.1Phvul.007G139900.1
Picea abiesMA_10427393g0010MA_161013g0010MA_10254g0020MA_10196428g0010MA_110832g0010
MA_10432190g0020MA_10236360g0010
Populus trichocarpaPotri.014G154500.1Potri.004G180500.1Potri.002G227600.1Potri.007G038300.2Potri.007G038300.1
Potri.004G180500.4Potri.002G013700.1Potri.004G010100.1Potri.005G247700.1Potri.007G038200.1
Potri.001G120300.1Potri.001G120300.3Potri.003G112700.1Potri.004G010100.2Potri.002G021000.1
Potri.001G000500.1Potri.014G177700.1Potri.003G224100.1Potri.012G126400.1Potri.001G000600.1
Potri.015G127200.1Potri.001G120300.2Potri.015G127200.2Potri.001G120300.4Potri.014G177700.2
Potri.008G032100.1Potri.008G032200.1Potri.003G224200.1Potri.004G180500.3Potri.004G180500.2
Prunus persicappa003877mppa004000mppa003872mppa003860mppa003926m
ppa003224mppa003733mppa003976mppa003715mppa005704m
ppa003219mppa003275mppa022550mppa021300m
Ricinus communis30170.m01431729683.m00047330010.m00066029842.m00357329676.m001645
28200.m00019329676.m00164728842.m00091330178.m00085530147.m014212
28842.m00091229475.m000236
Setaria italicaSi029411mSi006181mSi013462mSi006118mSi034997m
Si034798mSi034842mSi019624mSi029441mSi000880m
Si024626m
Selaginella moellendorffii229918410532403803418427
Sorghum bicolorSb02g034420.1Sb10g027270.1Sb07g003590.1Sb10g000470.1Sb01g017580.1
Sb01g035180.1Sb03g037970.1Sb09g023770.1Sb06g025300.1Sb02g001610.1
Thellungiella halophilaThhalv10018373mThhalv10024862mThhalv10007361mThhalv10003952mThhalv10007292m
Thhalv10024832mThhalv10003955mThhalv10028533mThhalv10018365mThhalv10018410m
Thhalv10013200mThhalv10003863mThhalv10013035mThhalv10024863mThhalv10020433m
Thhalv10011364mThhalv10011369mThhalv10020444mThhalv10024736mThhalv10004223m
Vitis viniferaGSVIVT01023902001GSVIVT01005054001GSVIVT01012709001GSVIVT01030441001GSVIVT01008707001
GSVIVT01005055001GSVIVT01003808001GSVIVT01001270001GSVIVT01005373001GSVIVT01004401001
GSVIVT01018624001GSVIVT01016181001
Zea maysAC177897.2_FGT022
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)