y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma15g00400.2
FamilyCE8
Protein PropertiesLength: 322 Molecular Weight: 35577.4 Isoelectric Point: 7.5228
ChromosomeChromosome/Scaffold: 15 Start: 195379 End: 199847
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE8222890
  VIVSKDGSGNYTTVSEAIMKAPDMSDKPYTIHVRAGTYEEYVTIPAKKTNIKLVGDGPHLTKLVGYQNGSTIDVRGDGFMAEKMGFENWAGLKASAAVAV
  RNEAKKSVFFECSIQGVQDTLWAVSGSQFYKNCDIYGTVDFIYGNAAAVFQDCMLYARYSEYVTFTAQSREDPKEKTGFSFQRCKFTMSPQDSARKSKVL
  RATLGRPLRAYSTVAIFHSYIDSMVDPKGWEPMAHQPTDKVTYIEFHNFGPGSKTDHRVDWPGVKVLS
Full Sequence
Protein Sequence     Length: 322     Download
MDSTTAVLLI FVSVLVCCHS TVIVSKDGSG NYTTVSEAIM KAPDMSDKPY TIHVRAGTYE    60
EYVTIPAKKT NIKLVGDGPH LTKLVGYQNG STIDVRGDGF MAEKMGFENW AGLKASAAVA    120
VRNEAKKSVF FECSIQGVQD TLWAVSGSQF YKNCDIYGTV DFIYGNAAAV FQDCMLYARY    180
SEYVTFTAQS REDPKEKTGF SFQRCKFTMS PQDSARKSKV LRATLGRPLR AYSTVAIFHS    240
YIDSMVDPKG WEPMAHQPTD KVTYIEFHNF GPGSKTDHRV DWPGVKVLSR PTPSAHYFTA    300
SYLLDADSWI PSTGVPFDNL L*                                             360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02416PLN024163.0e-8422319311+
PLN02713PLN027133.0e-8422317312+
PLN02468PLN024688.0e-8520317311+
PLN03043PLN030435.0e-8513317321+
pfam01095Pectinesterase5.0e-11022307299+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABN08348.1022319225532Pectinesterase; Pectinesterase inhibitor [Medicago truncatula]
EMBLCAN76835.1010321175497hypothetical protein [Vitis vinifera]
EMBLCBI24285.1010321122444unnamed protein product [Vitis vinifera]
RefSeqXP_002310960.1016317219538predicted protein [Populus trichocarpa]
RefSeqXP_002516192.1022319234541Pectinesterase PPE8B precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1xg2_A0203173311B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1gq8_A0223179315A Chain A, Pectin Methylesterase From Carrot
PDB1qjv_B0.00000000000002221806194A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB1qjv_A0.00000000000002221806194A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB2ntq_B0.00000000000002221806194A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2102EC-3.1.1.11pectinesterase
Transmembrane Domains
StartEnd
724
Signal Peptide
Cleavage Site
20
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FF39735322452240
HO778758309223170
DR054787268222760
CO475715291202970
HO777316315193170
Orthologous Group
SpeciesID
Phaseolus vulgarisPhvul.005G184400.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny