y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma15g01640.5
FamilyGT4
Protein PropertiesLength: 702 Molecular Weight: 78226.7 Isoelectric Point: 10.5488
ChromosomeChromosome/Scaffold: 15 Start: 1086101 End: 1090836
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT45566705.8e-22
  KADYVKSLLSFLEQHPNTSTSIFWTPATTRVASLYSAADVYVINSQGLGETFGRVTIEAMAFGLPVLGTDAGGTQEIVEHNVTGLLHPVGHPGNLVLAQN
  LWFLLKNQSARKQMG
Full Sequence
Protein Sequence     Length: 702     Download
MEESINRGEY QPNLAKQSSL RLGGSFKSTL SGRSTPRNSP SFRRLNSGRT PRKEGRSSVG    60
GALWFRSNRL LLWLLLITLW AYLGFFVQSR WAHSDKKEEF SGYGTGPRNT NSDAEQIQRR    120
DLLASNKSLS ANNDTDADIA GISKTINVAL AKNDNDVPSH RKTSSKNRSK GRRSSKGKSR    180
GKLKPTTEIK NTDIEEQEPE IPTTNSTYGL LVGPFGPMED RILEWSPEKR SGTCNRKEDF    240
ARLVWSRRFI LIFHELSMTG APLSMMELAT ELLSCGATVS AVVLSRKGGL MSELARRRIK    300
VLEDKADLSF KTAMKADLVI AGSAVCASWI EQYIEHFPAG ASQVAWWIME NRREYFDRSK    360
DVLHRVKMLV FLSESQSKQW QKWCEEESIK LRSHPEIVPL SVNDELAFVA GIPSTLNTPS    420
FSTEKMVEKK QLLRESVRKE MGLTDNDMLV ISLSSINPGK GQLLLLESVS SVLEQGQSPG    480
DKKMKEVSNI KEGLSSLARK HRIRKLLPLM SNGKVASNSI SSNSLSRRKQ VLPNDKGTIQ    540
QSLKLLIGSV RSKSNKADYV KSLLSFLEQH PNTSTSIFWT PATTRVASLY SAADVYVINS    600
QGLGETFGRV TIEAMAFGLP VLGTDAGGTQ EIVEHNVTGL LHPVGHPGNL VLAQNLWFLL    660
KNQSARKQMG VVGRKKVQKM YLKQQMYKNF VEVIARCMRS K*                       720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd03798GT1_wlbH_like1.0e-17585697113+
cd03800GT1_Sucrose_synthase7.0e-1858568197+
COG0438RfaG9.0e-19585701117+
cd03808GT1_cap1E_like5.0e-21577692116+
cd03801GT1_YqgM_like6.0e-25586694109+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN71826.1017011734hypothetical protein [Vitis vinifera]
EMBLCBI36173.1017011683unnamed protein product [Vitis vinifera]
RefSeqXP_002284822.10157014691PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002298139.1017011681predicted protein [Populus trichocarpa]
RefSeqXP_002528176.1017011686glycosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2jjm_L0.00000004586700278388A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_K0.00000004586700278388A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_J0.00000004586700278388A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_I0.00000004586700278388A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB2jjm_H0.00000004586700278388A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
Transmembrane Domains
StartEnd
7092
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FE7096452921073980
HS0643982481854320
FG1474092582054620
EY8095232442094520
GW8335872322224530
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00577.1Aquca_001_00590.2Aquca_001_00590.1
Arabidopsis lyrata889408316473897892474368
Arabidopsis thalianaAT1G19710.1AT1G75420.1AT3G15940.2AT3G15940.1AT1G52420.1
Brachypodium distachyonBradi2g09620.1
Brassica rapaBra025759Bra027200Bra030384
Carica papayaevm.model.supercontig_99.5evm.model.supercontig_253.2
Capsella rubellaCarubv10020237mCarubv10011399mCarubv10013095m
Citrus clementinaCiclev10025538mCiclev10001031mCiclev10024994m
Citrus sinensisorange1.1g023290morange1.1g017123morange1.1g017085morange1.1g012132morange1.1g011954m
orange1.1g004942morange1.1g004760m
Cucumis sativusCucsa.105340.1Cucsa.300870.1
Eucalyptus grandisEucgr.F01601.1Eucgr.F03009.1Eucgr.J03011.1
Fragaria vescamrna15198.1-v1.0-hybridmrna14930.1-v1.0-hybridmrna05979.1-v1.0-hybrid
Glycine maxGlyma04g03170.1Glyma06g03220.1Glyma15g01640.6Glyma15g01640.4Glyma15g01640.3
Glyma08g22160.2Glyma07g03870.1Glyma13g43720.1
Gossypium raimondiiGorai.009G198800.1Gorai.003G012600.2Gorai.003G012600.1Gorai.007G199800.4Gorai.007G199800.3
Gorai.007G199800.1Gorai.009G132600.4Gorai.009G132600.3Gorai.009G132600.2Gorai.009G132600.1
Gorai.002G058400.1Gorai.011G077500.1
Linum usitatissimumLus10041786Lus10028338Lus10024281Lus10011469Lus10037523
Malus domesticaMDP0000210114MDP0000312093MDP0000064350MDP0000204168
Manihot esculentacassava4.1_006962mcassava4.1_006727mcassava4.1_002537m
Medicago truncatulaMedtr4g069840.1
Mimulus guttatusmgv1a005641mmgv1a002407m
Oryza sativaLOC_Os01g15780.1
Panicum virgatumPavirv00028369m
Physcomitrella patensPp1s24_249V6.3
Phaseolus vulgarisPhvul.009G060600.1Phvul.010G151400.1Phvul.005G172300.2Phvul.005G172300.1
Picea abiesMA_159042g1120
Populus trichocarpaPotri.005G118800.1Potri.002G031300.1Potri.001G179000.1Potri.001G179000.5
Prunus persicappa005334mppa005118mppa002059m
Ricinus communis30170.m01409429872.m00052635599.m00001450675.m000024
Setaria italicaSi002128m
Selaginella moellendorffii10326098243
Sorghum bicolorSb03g010200.1
Thellungiella halophilaThhalv10007567mThhalv10007509mThhalv10018489mThhalv10020188mThhalv10011288m
Thhalv10011286m
Vitis viniferaGSVIVT01009775001GSVIVT01018875001GSVIVT01017132001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)