y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma15g03670.1
FamilyGT1
Protein PropertiesLength: 485 Molecular Weight: 53726.4 Isoelectric Point: 5.4861
ChromosomeChromosome/Scaffold: 15 Start: 2576380 End: 2578398
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT12354587.3e-36
  FKRKLGRPVWPIGPVLFSSGSGSGSRGKGGGINPNLCTEWLNTKPSKSVLFVCFGSMNTISALQMMELGKALERCGKNFVWVVRPPIGFDINSEFREGEW
  LPEGFVERVKESGKGLVVHDWAPQVEILSHFAVSAFLSHCGWNSVLESLSQGVPILGWPMAAEQFYNCKLLEEEVGVCVEVARGKSSEVKYEDIVAKIEL
  VMDETEKGVAMGKKAGDVRDMIRD
Full Sequence
Protein Sequence     Length: 485     Download
MAETEGKQEA VLFPFMAQGH IIPFLALALE LEQRKKYSIT ILNTSLNIKK LRSSIPPDST    60
ISLVEIPFTP SDHGLPPNTE NTDSIPYHLV IRLIQASTTL QPAFKTLIQN ILFQNQKHQL    120
LIISDIFFGW TATVAKELGV FHVVFSGTSG FGLACYYSLW HNLPHRRVNS DEFSLPDFPE    180
ARVIHRTQLP NNISEADGTD PWSVFQKSNL SQWVNSDGIL FNTVEEFDSV GLGYFKRKLG    240
RPVWPIGPVL FSSGSGSGSR GKGGGINPNL CTEWLNTKPS KSVLFVCFGS MNTISALQMM    300
ELGKALERCG KNFVWVVRPP IGFDINSEFR EGEWLPEGFV ERVKESGKGL VVHDWAPQVE    360
ILSHFAVSAF LSHCGWNSVL ESLSQGVPIL GWPMAAEQFY NCKLLEEEVG VCVEVARGKS    420
SEVKYEDIVA KIELVMDETE KGVAMGKKAG DVRDMIRDAV KDEDGFKGSS VRAMDEFLSA    480
AFES*                                                                540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN00164PLN001642.0e-52122474375+
PLN02167PLN021674.0e-537483508+
PLN02534PLN025345.0e-6911470482+
PLN02863PLN028631.0e-745483489+
PLN03007PLN030078.0e-7911478489+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002283018.1044822480PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002283024.1054822479PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002283039.1054812474PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002297794.1044812479predicted protein [Populus trichocarpa]
RefSeqXP_002513452.1074815479UDP-glucosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2vg8_A7.00005e-4114741460A Chain A, Crystal Structure Of The Geobacillus Stearothermophilus Carboxylesterase Est55 At Ph 6.2
PDB2vch_A7.00005e-4114741460A Chain A, Crystal Structure Of The Geobacillus Stearothermophilus Carboxylesterase Est55 At Ph 6.2
PDB2vce_A7.00005e-4114741460A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB2acv_B4e-3814623446A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
PDB2acv_A4e-3814623446A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1
Metabolic Pathways
Pathway NameReactionECProtein Name
betacyanin biosynthesisRXN-8481EC-2.4.1UDPG:cyclo-DOPA 5-O-glucosyltransferase
Transmembrane Domains
StartEnd
1029
138160
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CF80592223152350
CO9832242022844850
FF3908952412304700
BM89296218231840
FP030053277112860
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00895.1Aquca_009_00215.1Aquca_009_00214.1
Arabidopsis lyrata909236
Arabidopsis thalianaAT5G12890.1
Brachypodium distachyonBradi5g15060.1
Brassica rapaBra008873
Carica papayaevm.model.supercontig_84.97
Capsella rubellaCarubv10003346m
Citrus clementinaCiclev10017842mCiclev10000917mCiclev10027266mCiclev10015056mCiclev10017937m
Ciclev10015021mCiclev10015029mCiclev10015045mCiclev10015019mCiclev10017546m
Ciclev10016844m
Citrus sinensisorange1.1g041323morange1.1g035495morange1.1g042731morange1.1g011106morange1.1g043168m
orange1.1g043304morange1.1g047833morange1.1g040467m
Cucumis sativusCucsa.094380.1Cucsa.065340.1
Eucalyptus grandisEucgr.J00809.1Eucgr.H02623.1Eucgr.H00447.1Eucgr.H00444.1Eucgr.H00443.1
Eucgr.H00446.1
Fragaria vescamrna22484.1-v1.0-hybrid
Glycine maxGlyma14g04790.1Glyma02g44100.1Glyma14g04800.1Glyma14g04811.1
Gossypium raimondiiGorai.004G091900.1Gorai.005G017000.1Gorai.007G232800.1
Linum usitatissimumLus10031248Lus10031819Lus10025513Lus10025515
Malus domesticaMDP0000718378MDP0000244877MDP0000315574MDP0000191048MDP0000268507
MDP0000888095MDP0000423529MDP0000893993MDP0000796379MDP0000618774
MDP0000611903MDP0000264453
Manihot esculentacassava4.1_005848mcassava4.1_033842mcassava4.1_034196m
Medicago truncatulaMedtr5g087620.1Medtr2g098430.1
Mimulus guttatusmgv11b017767mmgv1a019043m
Oryza sativaLOC_Os04g20474.4LOC_Os04g20474.3LOC_Os04g20474.2LOC_Os04g20474.1LOC_Os04g42690.1
LOC_Os04g20260.1LOC_Os04g20330.1LOC_Os04g20540.1
Panicum virgatumPavirv00043406mPavirv00039645mPavirv00049770mPavirv00039309mPavirv00069822m
Pavirv00019348mPavirv00023527m
Physcomitrella patensPp1s45_276V6.1Pp1s46_163V6.1Pp1s232_57V6.1Pp1s73_170V6.1Pp1s44_128V6.1
Pp1s339_8V6.1
Phaseolus vulgarisPhvul.008G208400.1Phvul.008G208500.1Phvul.008G208600.1Phvul.005G149900.1
Picea abiesMA_2420g0020MA_508766g0010MA_173074g0010MA_6763613g0010MA_901161g0010
MA_619336g0010MA_10433869g0010MA_10427810g0010MA_104361g0010MA_8779645g0010
MA_7909224g0010MA_432761g0010MA_47308g0010MA_365297g0010MA_10426944g0020
MA_9569707g0010MA_26811g0010MA_407162g0010MA_495649g0010MA_103636g0020
MA_4331330g0010MA_10436818g0020MA_6456g0020MA_10426647g0010MA_70127g0010
MA_10431618g0010MA_237379g0010MA_10427592g0020MA_10434729g0020MA_10182116g0010
MA_103506g0010MA_333155g0010MA_95818g0010MA_10425895g0020MA_158042g0010
MA_220754g0010MA_10417695g0010MA_201086g0010MA_8682761g0010MA_9188108g0010
MA_551352g0010MA_263300g0010MA_10429280g0010MA_8649321g0010MA_1132847g0010
Populus trichocarpaPotri.001G016300.1Potri.017G077500.1Potri.017G077800.1Potri.017G077400.1Potri.017G077700.1
Potri.003G210400.1Potri.001G016500.1
Prunus persicappa016005mppa022989mppa021821mppa004601mppa023949m
ppa015738m
Ricinus communis30169.m00639829888.m00032529888.m000328
Setaria italicaSi012787mSi035407mSi012786mSi011731m
Sorghum bicolorSb03g007940.1Sb06g021900.1Sb06g020400.1Sb09g026740.1Sb01g047220.1
Sb01g014390.1
Thellungiella halophilaThhalv10015476m
Vitis viniferaGSVIVT01031678001GSVIVT01025320001.143.342GSVIVT01025320001.143.342GSVIVT01025320001.570.722GSVIVT01025320001.570.722
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)