y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma15g06366.1
FamilyGT47
Protein PropertiesLength: 136 Molecular Weight: 15675.7 Isoelectric Point: 5.9125
ChromosomeChromosome/Scaffold: 15 Start: 4505510 End: 4508164
DescriptionExostosin family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT47111281.1e-25
  MIDEVEKYVEHLKLKYPYWNRTLGADHFFVTCHDIGVKATKGVPHLTKNSIRVACSSSYDDDDYVPHKDVTLPQVQLPFFHPPGENDIKNRNTFAFWAGR
  SDSRLKDDLMAMWDNDTE
Full Sequence
Protein Sequence     Length: 136     Download
MNMQGLTIER MIDEVEKYVE HLKLKYPYWN RTLGADHFFV TCHDIGVKAT KGVPHLTKNS    60
IRVACSSSYD DDDYVPHKDV TLPQVQLPFF HPPGENDIKN RNTFAFWAGR SDSRLKDDLM    120
AMWDNDTELD IQNKS*                                                    180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03016Exostosin3.0e-1612109102+
Gene Ontology
GO TermDescription
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN72733.10313361190hypothetical protein [Vitis vinifera]
EMBLCBI38234.10113364195unnamed protein product [Vitis vinifera]
RefSeqXP_002303415.10113364195predicted protein [Populus trichocarpa]
RefSeqXP_002307304.101133144275predicted protein [Populus trichocarpa]
RefSeqXP_002522880.101133144275catalytic, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CA92532513221330
CA92520513221330
DC59640313311330
GO36051913311330
EX31786913311330
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_006_00421.1
Carica papayaevm.model.supercontig_776.2
Citrus clementinaCiclev10033889m
Citrus sinensisorange1.1g038978m.17.118orange1.1g038978m.17.118
Cucumis sativusCucsa.165010.1
Eucalyptus grandisEucgr.J02121.1
Fragaria vescamrna07685.1-v1.0-hybrid.216.351mrna20856.1-v1.0-hybridmrna07685.1-v1.0-hybrid.216.351
Gossypium raimondiiGorai.011G269900.1
Malus domesticaMDP0000813554MDP0000127117
Manihot esculentacassava4.1_001828m
Medicago truncatulaMedtr5g081290.1
Mimulus guttatusmgv1a009039m
Physcomitrella patensPp1s171_117V6.1Pp1s171_119V6.1Pp1s171_119V6.2Pp1s7_425V6.1Pp1s171_119V6.3
Picea abiesMA_9984677g0010MA_163950g0010MA_136494g0010
Populus trichocarpaPotri.007G117800.1Potri.012G091600.1Potri.008G060500.1Potri.010G197900.1
Prunus persicappa001357m
Ricinus communis30143.m001199
Selaginella moellendorffii445668
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny