y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma15g08020.3
FamilyGT48
Protein PropertiesLength: 1800 Molecular Weight: 208412 Isoelectric Point: 9.5144
ChromosomeChromosome/Scaffold: 15 Start: 5640732 End: 5647557
Descriptionglucan synthase-like 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT4890016570
  VPLNLEARRRIAFFTNSLFMNIPRAPYVEKMMAFSVLTPYYDEEVLYSKEALRKENEDGITTLFYLQKIYEDEWKNFMERMHREGLKDEEAIWTEKARDL
  RLWVSHRGQTLSRTVRGMMYYYRGLKMLAFLDSASEMDVRQGSEHGSTNQNSSLNGLPSNGPSSLQTNLRPTGSSVSMLFKGHEYGSALMKFSYVVACQI
  YGRHKADKNPRADEILYLMQHNEALRVAYVDEVSLGREGTEYYSVLVKYDQQLQSEVEIYRIRLPGPLKLGEGKPENQNHAIIFTRGDAVQTIDMNQDNY
  FEEALKMRNLLEEFNMSYGIKKPTILGVRENIFTGSVSSLAWFMSAQETSFVTLGQRVLANPLKVRMHYGHPDVFDRFWFLGRGGVSKASRVINISEDIF
  AGFNCTLRGGNVTHHEYIQVGKGRDVGLNQISMFEAKIASGNGEQVLSRDVYRLGHRLDFFRMLSVFYTTIGFYFNSMVIVLMVYAFLWGRLYMALSGIE
  HGIKHAAMNNATNNKALGAVLNQQFAIQVGIFTALPMVVENSLEHGFLPAVWDFLTMQLQLASLFYTFSLGTRTHFFGRTILHGGAKYRATGRGFVVAHK
  SFAENYRLYARSHFVKGIELGVILIVYAAHSPLARDTFLYIVMTISSWFLVVSWIMSPFVFNPSGFDWLKTVYDFEDFINWIWYPGGPFKKAEYSWETWW
  YEEQDHLRTTGIWGKLLEIILNLRFFFFQYGIVYQLGITGENNSIAVYLLSWIVMVVL
Full Sequence
Protein Sequence     Length: 1800     Download
MPSKTVWIAT NRLTLNVVVS VTMNLTQRPV AQRGGASNLP RPPPPPLNSV FNIIPVHDLL    60
TDHPSLRYPE VRAAAAALRT VGDLPKHQFM RWEPEMDLLD WLRLLFGFQL DNARNQREHL    120
VLHLANSQMR LEPPPAIVDA LDAGVLRRFR RKLLHNYTAW CSFLGLKSNV LLSRRRDPTD    180
LRRELLYVSL YLLVWGEAGN LRFTPECLCY IYHFMAKELN HVIDEHIDPD TGRPYMPTVS    240
GELGFLKSVI MPIYNTIKVE VDSSRNGKAP HSAWRNYDDI NEYFWSRRCL KRLGWPLNFE    300
CNFFGTTPKE KRVGKTGFVE QRSFWNVYKS FDRLWVMLIL FFQAAVIVAW EGTTYPWQAL    360
ERRDVQVKML TVFITWSALR LLQSVLDAGT QYSLVTRETT WLGVRMTLKS MVAITWTVLF    420
SVFYGMIWIE KGSRPIWSDA ANQRIYTFLK VVLFFLIPEL LALVLFVVPW LRNVIEESDW    480
RIVYMLMWWF HNRIFVGRGV RQALVDNVKY TVFWVAVLAS KFSFSYFVQI KPLVAPTKAL    540
LNLKSIPSKW HEFFSNTNRV AVVLLWLPVV LVYFMDLQIW YSIFSAFYGA AIGLFSHLGE    600
IRNVTQLRLR FQFFASAMQF NLMPEEKLLS QQATLLKKLR DAIHRLKLRY GLGQPFNKIE    660
SSQVDATRFA LIWNEIMITF REEDIISDRE LELLKLPPNC WNIRVIRWPC SLLCNELLLA    720
VSQAKELENE SDQSLWLKIC KNEYRRCAVF EAYDSVKYLF PKVLKAEKEE HFIMINIFKV    780
IDSYIQMGKL TEAFKMSRLP QIHAKVSEFV QLLIQPERDM NKAVNLLQAL YELFVREFPK    840
AKKTIIQLRE EGLARRSSTA DEGLIFENAV KFPDAGDAIF TEQLRRLHTI LTSRDSMHNV    900
PLNLEARRRI AFFTNSLFMN IPRAPYVEKM MAFSVLTPYY DEEVLYSKEA LRKENEDGIT    960
TLFYLQKIYE DEWKNFMERM HREGLKDEEA IWTEKARDLR LWVSHRGQTL SRTVRGMMYY    1020
YRGLKMLAFL DSASEMDVRQ GSEHGSTNQN SSLNGLPSNG PSSLQTNLRP TGSSVSMLFK    1080
GHEYGSALMK FSYVVACQIY GRHKADKNPR ADEILYLMQH NEALRVAYVD EVSLGREGTE    1140
YYSVLVKYDQ QLQSEVEIYR IRLPGPLKLG EGKPENQNHA IIFTRGDAVQ TIDMNQDNYF    1200
EEALKMRNLL EEFNMSYGIK KPTILGVREN IFTGSVSSLA WFMSAQETSF VTLGQRVLAN    1260
PLKVRMHYGH PDVFDRFWFL GRGGVSKASR VINISEDIFA GFNCTLRGGN VTHHEYIQVG    1320
KGRDVGLNQI SMFEAKIASG NGEQVLSRDV YRLGHRLDFF RMLSVFYTTI GFYFNSMVIV    1380
LMVYAFLWGR LYMALSGIEH GIKHAAMNNA TNNKALGAVL NQQFAIQVGI FTALPMVVEN    1440
SLEHGFLPAV WDFLTMQLQL ASLFYTFSLG TRTHFFGRTI LHGGAKYRAT GRGFVVAHKS    1500
FAENYRLYAR SHFVKGIELG VILIVYAAHS PLARDTFLYI VMTISSWFLV VSWIMSPFVF    1560
NPSGFDWLKT VYDFEDFINW IWYPGGPFKK AEYSWETWWY EEQDHLRTTG IWGKLLEIIL    1620
NLRFFFFQYG IVYQLGITGE NNSIAVYLLS WIVMVVLVAI YIIIAYAQDK YATKEHLYYR    1680
LVQLLVIVVT VLVLFLLLEF AHLKFLDLLS SFLAFVPTGW GMISIAQVLR PFLQTTKVWE    1740
TVVSLARLYD LLFGVIVMAP MAMLSWLPGF QSMQTRILFN EAFSRGLQIS RIVSGKKSV*    1800
                                                                     1860
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam14288FKS1_dom12.0e-53182296115+
pfam02364Glucan_synthase08981651812+
Gene Ontology
GO TermDescription
GO:00001481,3-beta-D-glucan synthase complex
GO:00038431,3-beta-D-glucan synthase activity
GO:0006075(1->3)-beta-D-glucan biosynthetic process
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001044278.10471799211788Os01g0754200 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_192264.10261798121776ATGSL05 (GLUCAN SYNTHASE-LIKE 5); 1,3-beta-glucan synthase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqNP_567278.10461799151768GSL1 (GLUCAN SYNTHASE-LIKE 1); 1,3-beta-glucan synthase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqXP_002263757.1023149911468PREDICTED: hypothetical protein, partial [Vitis vinifera]
RefSeqXP_002517915.10411798141767transferase, transferring glycosyl groups, putative [Ricinus communis]
Metabolic Pathways
Pathway NameReactionECProtein Name
callose biosynthesis13-BETA-GLUCAN-SYNTHASE-RXNEC-2.4.1.341,3-β-glucan synthase
Transmembrane Domains
StartEnd
334353
411428
448470
480497
510530
557574
579601
13661388
14161438
14531470
15371559
16151637
16441666
16811703
17081730
17451767
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO425519630117517990
HO78074653393014570
HO801980236123114640
HO801980172146416350
HO780496341122915690
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_056_00094.1Aquca_014_00906.1Aquca_019_00181.4Aquca_019_00181.3Aquca_019_00181.1
Aquca_016_00166.1Aquca_019_00181.2Aquca_084_00016.4Aquca_084_00016.3Aquca_084_00016.2
Aquca_084_00016.1Aquca_022_00132.2Aquca_022_00132.1Aquca_014_00908.4Aquca_014_00908.3
Aquca_014_00908.2Aquca_014_00908.1Aquca_014_00908.5Aquca_008_00266.1Aquca_039_00091.4
Aquca_039_00091.2Aquca_039_00091.1Aquca_039_00091.3Aquca_056_00094.2
Arabidopsis lyrata340908482666470669899601907409
878725482124490214490142897726
325786
Arabidopsis thalianaAT3G07160.1AT2G36850.1AT1G06490.1AT4G03550.1AT2G13680.1
AT1G05570.2AT1G05570.1AT4G04970.1AT3G59100.1AT2G31960.2
AT2G31960.1AT5G13000.1AT5G13000.2AT3G14570.2AT3G14570.1
AT5G36870.1
Brachypodium distachyonBradi1g51757.1Bradi1g77247.2Bradi1g77247.1Bradi1g47427.1Bradi2g50140.1
Bradi3g60790.2Bradi3g60790.1Bradi1g29622.1Bradi1g76617.1Bradi2g46250.1
Bradi2g40460.1Bradi3g09317.1Bradi2g40430.1
Brassica rapaBra005239Bra029628Bra001239Bra040364Bra015504
Bra034218Bra032416Bra037213Bra029541Bra015436
Bra003364Bra023386Bra008864Bra005624Bra027328
Carica papayaevm.model.supercontig_42.151evm.model.supercontig_189.7evm.model.supercontig_25.167evm.model.supercontig_858.3evm.model.supercontig_2050.2
evm.model.supercontig_3407.1evm.model.supercontig_50.100evm.model.supercontig_4.57
Capsella rubellaCarubv10022498mCarubv10022499m
Citrus clementinaCiclev10014066mCiclev10018457mCiclev10018456mCiclev10000018mCiclev10018223m
Ciclev10030477mCiclev10030476mCiclev10014015mCiclev10030481mCiclev10030478m
Ciclev10030495mCiclev10024186mCiclev10030599mCiclev10030560mCiclev10030796m
Citrus sinensisorange1.1g000946morange1.1g000813morange1.1g000382morange1.1g000253morange1.1g000219m
orange1.1g000179morange1.1g000260morange1.1g000273morange1.1g000180morange1.1g000261m
orange1.1g045737morange1.1g000259morange1.1g000258morange1.1g001004morange1.1g000585m
orange1.1g000171morange1.1g000349morange1.1g000165morange1.1g001473morange1.1g000389m
orange1.1g000385morange1.1g040336morange1.1g000763m
Cucumis sativusCucsa.157510.4Cucsa.157510.3Cucsa.157510.2Cucsa.157510.1Cucsa.142920.1
Cucsa.249900.1Cucsa.119100.1Cucsa.126670.1Cucsa.239610.1Cucsa.049980.10
Cucsa.142930.1Cucsa.049980.1Cucsa.058220.1Cucsa.058230.1
Eucalyptus grandisEucgr.B00160.1Eucgr.B03640.2Eucgr.B03640.1Eucgr.I00208.1Eucgr.K01028.4
Eucgr.K01028.3Eucgr.K01028.2Eucgr.K01028.1Eucgr.D00621.1Eucgr.A01821.1
Eucgr.K01027.1Eucgr.D00622.1Eucgr.J00836.1Eucgr.J00827.1Eucgr.F01403.1
Eucgr.A01827.1Eucgr.A02008.1Eucgr.A01817.1Eucgr.A01994.2Eucgr.A01994.1
Eucgr.A02010.1Eucgr.J00836.2Eucgr.A01997.1
Fragaria vescamrna09912.1-v1.0-hybridmrna17912.1-v1.0-hybridmrna17710.1-v1.0-hybridmrna28731.1-v1.0-hybridmrna02397.1-v1.0-hybrid
mrna24411.1-v1.0-hybridmrna26782.1-v1.0-hybridmrna28728.1-v1.0-hybrid.526.840mrna28728.1-v1.0-hybrid.526.840
Glycine maxGlyma06g18216.1Glyma04g36725.1Glyma20g38860.1Glyma10g44150.1Glyma05g32500.4
Glyma05g32500.3Glyma05g32500.2Glyma08g16660.1Glyma04g39120.2Glyma04g39120.1
Glyma13g37290.2Glyma08g42150.3Glyma08g42150.2Glyma08g42150.1Glyma18g12870.3
Glyma18g12870.2Glyma18g12870.1Glyma15g08020.2Glyma15g08020.1Glyma15g42330.4
Glyma15g42330.3Glyma15g42330.2Glyma18g53823.1Glyma08g47670.1Glyma08g47670.2
Glyma18g13105.9Glyma18g13105.8Glyma18g13105.7Glyma18g13105.6Glyma18g13105.10
Glyma18g13105.3Glyma18g13105.2Glyma18g13105.1Glyma18g13105.5Glyma18g13105.4
Glyma15g39420.2Glyma13g33560.1Glyma05g32500.6Glyma05g32500.5Glyma08g42110.1
Glyma06g44770.3Glyma06g44770.2Glyma13g31310.1Glyma06g44770.4Glyma10g44150.2
Glyma08g16715.1Glyma06g15860.1.320.682Glyma06g15860.1.320.682Glyma08g16730.2
Gossypium raimondiiGorai.004G018200.3Gorai.004G018200.1Gorai.004G018200.2Gorai.003G109000.6Gorai.003G109000.1
Gorai.003G109000.2Gorai.003G109000.3Gorai.003G109000.4Gorai.011G120300.1Gorai.005G201500.2
Gorai.005G201500.1Gorai.011G119900.1Gorai.013G075600.1Gorai.004G092500.3Gorai.004G092500.2
Gorai.004G092500.1Gorai.011G096900.3Gorai.011G096900.1Gorai.004G092600.3Gorai.004G092600.1
Gorai.009G169700.3Gorai.009G169700.2Gorai.009G169700.1Gorai.012G187400.3Gorai.012G187400.2
Gorai.012G187400.1Gorai.004G092600.2Gorai.004G092600.4Gorai.012G040000.2Gorai.012G040000.1
Gorai.005G042700.1Gorai.005G043100.1Gorai.012G128700.1Gorai.007G334800.1Gorai.007G334800.2
Gorai.003G109000.5
Linum usitatissimumLus10014796Lus10032463Lus10039828Lus10000266Lus10031648
Lus10033689Lus10001424Lus10001056Lus10003920Lus10039199
Lus10037469Lus10013744Lus10033483Lus10007327Lus10030030
Lus10042478Lus10020893Lus10020750Lus10040891.301.669Lus10040891.301.669
Lus10002096Lus10002097
Malus domesticaMDP0000174437MDP0000286691MDP0000245319MDP0000275961MDP0000915307
MDP0000229527MDP0000230907MDP0000203763MDP0000321472MDP0000220467
MDP0000308574MDP0000198973MDP0000230621MDP0000212172.415.839MDP0000212172.415.839
MDP0000372473MDP0000310065MDP0000213931MDP0000218486.624.863MDP0000218486.624.863
MDP0000218486.624.863
Manihot esculentacassava4.1_001919mcassava4.1_031653mcassava4.1_029201mcassava4.1_000111mcassava4.1_000342m
cassava4.1_000112mcassava4.1_000082mcassava4.1_026004mcassava4.1_002527mcassava4.1_003374m
cassava4.1_003342mcassava4.1_006866mcassava4.1_028751mcassava4.1_033421m
Medicago truncatulaMedtr4g078220.1Medtr3g047390.1Medtr7g005950.1Medtr1g116370.1AC235753_1023.1
Medtr1g116470.1.521.981Medtr1g116470.1.521.981Medtr1g116470.1.228.504Medtr1g116470.1.228.504
Mimulus guttatusmgv1a000080mmgv1a000075mmgv1a000084mmgv1a000082mmgv1a000070m
mgv1a000067mmgv1a000108mmgv1a024191mmgv1a000066mmgv1a000106m
mgv1a000068m
Oryza sativaLOC_Os06g08380.1LOC_Os02g58560.1LOC_Os01g55040.1LOC_Os06g51270.1LOC_Os03g03610.3
LOC_Os03g03610.2LOC_Os03g03610.1LOC_Os02g58560.3LOC_Os02g14900.1LOC_Os01g34930.1
LOC_Os01g48200.1LOC_Os01g34890.1LOC_Os01g34880.1
Panicum virgatumPavirv00009928mPavirv00009617mPavirv00009495mPavirv00057448mPavirv00022973m
Pavirv00045342mPavirv00015084mPavirv00020404mPavirv00041942mPavirv00010502m
Pavirv00026821mPavirv00007196mPavirv00061397mPavirv00045035mPavirv00040188m
Pavirv00056028mPavirv00049749mPavirv00048524mPavirv00058599m
Physcomitrella patensPp1s88_136V6.1Pp1s160_88V6.1Pp1s40_186V6.2Pp1s67_234V6.1Pp1s67_70V6.1
Pp1s145_49V6.1Pp1s18_300V6.2Pp1s199_13V6.1Pp1s13_132V6.1Pp1s13_432V6.1
Pp1s379_24V6.1Pp1s66_72V6.1
Phaseolus vulgarisPhvul.007G004900.2Phvul.007G004900.1Phvul.007G004900.3Phvul.002G272000.1Phvul.009G150300.2
Phvul.009G150300.1Phvul.011G113800.1Phvul.006G185600.2Phvul.006G185600.1Phvul.006G032100.1
Phvul.006G031900.1Phvul.005G103600.1Phvul.008G002300.1Phvul.005G040900.2Phvul.007G005100.1
Phvul.005G040900.1Phvul.005G062500.1Phvul.009G169400.1
Picea abiesMA_10428413g0040MA_826577g0010MA_960362g0010MA_10426974g0030MA_735748g0010
MA_6205g0020MA_10426974g0020MA_10430560g0010MA_10431062g0010MA_229544g0010
MA_10434444g0010MA_10431631g0010
Populus trichocarpaPotri.015G089300.1Potri.001G011900.1Potri.005G058300.2Potri.005G058300.1Potri.013G131300.1
Potri.001G230000.9Potri.001G230000.8Potri.001G230000.7Potri.001G230000.6Potri.001G230000.5
Potri.001G230000.4Potri.001G230000.3Potri.001G230000.2Potri.001G230000.17Potri.001G230000.16
Potri.011G052400.6Potri.011G052400.5Potri.011G052400.4Potri.011G052400.3Potri.011G052400.2
Potri.011G052400.1Potri.002G058700.3Potri.002G058700.2Potri.002G058700.1Potri.001G012200.3
Potri.001G012200.1Potri.001G012200.2Potri.005G203500.2Potri.005G203500.1Potri.003G214200.2
Potri.003G214200.1Potri.011G095100.2Potri.011G095100.1Potri.001G230000.10Potri.001G230000.18
Potri.001G012200.5Potri.001G012200.4Potri.005G203500.3Potri.001G230000.11Potri.001G230000.12
Potri.001G230000.13
Prunus persicappa000071mppa000167mppa000077mppa000074mppa001863m
ppa000121mppa000112mppa002267mppa000073mppa003008m
ppa000306m
Ricinus communis30147.m01381228035.m00035829691.m00028229983.m00319129734.m000419
28035.m00035929759.m00028130226.m00202329983.m00319229851.m002416
Setaria italicaSi033860mSi034369mSi034352mSi008368mSi016068m
Si016067mSi000021mSi000023mSi000022mSi000017m
Si033956mSi033893mSi033872mSi016150mSi000059m
Selaginella moellendorffii133452439692163802267830177798
449402
Sorghum bicolorSb10g005550.1Sb04g038510.1Sb10g030970.1Sb01g048630.1Sb03g023490.1
Sb03g030800.1Sb03g034880.1Sb04g008830.1
Thellungiella halophilaThhalv10019878mThhalv10016126mThhalv10006529mThhalv10022518mThhalv10028360m
Thhalv10028359mThhalv10006533mThhalv10006528mThhalv10016125mThhalv10012412m
Thhalv10005734mThhalv10019876mThhalv10029222m
Vitis viniferaGSVIVT01025370001GSVIVT01007560001GSVIVT01026489001GSVIVT01001361001GSVIVT01020854001
GSVIVT01025362001GSVIVT01000622001GSVIVT01005204001GSVIVT01020548001.494.863GSVIVT01020548001.494.863
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)