y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma15g11290.2
FamilyGH1
Protein PropertiesLength: 526 Molecular Weight: 60001.7 Isoelectric Point: 6.3071
ChromosomeChromosome/Scaffold: 15 Start: 8266254 End: 8275182
Descriptionbeta-glucosidase 47
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1395100
  SPFPSNFLFGTASSSYQFEGAYLTDGKGLNNWDVFTHKPGTIMDGTNGDVAVDHYHRYQEDVDLMDYIGVNSYRFSLSWARILPKGRFGKVNWAGIDYYN
  QLVDTIVSKEIEPFVTMSHYDIPLELEERYGGWLSPEIQEDFKYYANICFKNFGDRVKYWVTFNEPNVATIRGYRTGMWPPSRCSGSFGNCSYGGDSERE
  PFIAASNLLLSHAVAVDLYRTKYQKKQGGKIGVVMNAIWFEPVSNSWKDKLAAERAQSFYMNWFLDPIIIGEYPAEMHEILGQDLPTFSRYDVEKLKSGL
  DFIGVNHYTSAFAKDCIFSACEQGRGSSRTEGFTLRSPQMNGISIGEPTALDWLYVHPQGMEKILTYLKHRYNNIPMFITENGIGMRENSNHATKEIIND
  VERVEYLRGYLDSLATAIRKGADVRGYFVWSLLDNFEWTDGYSIRFGLHHVDYATLNRTPRMSAFWYKNFIA
Full Sequence
Protein Sequence     Length: 526     Download
MELPLLAHHA LFALSFCISI FLASCDDDFL SVKKNSSSSP FPSNFLFGTA SSSYQFEGAY    60
LTDGKGLNNW DVFTHKPGTI MDGTNGDVAV DHYHRYQEDV DLMDYIGVNS YRFSLSWARI    120
LPKGRFGKVN WAGIDYYNQL VDTIVSKEIE PFVTMSHYDI PLELEERYGG WLSPEIQEDF    180
KYYANICFKN FGDRVKYWVT FNEPNVATIR GYRTGMWPPS RCSGSFGNCS YGGDSEREPF    240
IAASNLLLSH AVAVDLYRTK YQKKQGGKIG VVMNAIWFEP VSNSWKDKLA AERAQSFYMN    300
WFLDPIIIGE YPAEMHEILG QDLPTFSRYD VEKLKSGLDF IGVNHYTSAF AKDCIFSACE    360
QGRGSSRTEG FTLRSPQMNG ISIGEPTALD WLYVHPQGME KILTYLKHRY NNIPMFITEN    420
GIGMRENSNH ATKEIINDVE RVEYLRGYLD SLATAIRKGA DVRGYFVWSL LDNFEWTDGY    480
SIRFGLHHVD YATLNRTPRM SAFWYKNFIA LHAPRAGTRP QHTQE*                   540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02814PLN028148.0e-13048509468+
PLN02849PLN028499.0e-13248509467+
COG2723BglB3.0e-14048510469+
TIGR03356BGL2.0e-16248505461+
pfam00232Glyco_hydro_14.0e-17648514476+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI23186.10851316520unnamed protein product [Vitis vinifera]
RefSeqNP_193907.202751243514BGLU47 (Beta-glucosidase 47); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana]
RefSeqXP_002305594.104151029495predicted protein [Populus trichocarpa]
RefSeqXP_002305597.102851025506predicted protein [Populus trichocarpa]
RefSeqXP_002518516.103751230504beta-glucosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3gnr_A04150917486X Chain X, Crystal Structure Of The Full-Length Autotransporter Esta From Pseudomonas Aeruginosa
PDB3gnp_A04150917486X Chain X, Crystal Structure Of The Full-Length Autotransporter Esta From Pseudomonas Aeruginosa
PDB3gno_A04150917486A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB2rgm_B03750916479A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB2rgm_A03750916479A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
Metabolic Pathways
Pathway NameReactionECProtein Name
coumarin biosynthesis (via 2-coumarate)RXN-8036EC-3.2.1.21β-glucosidase
linamarin degradationRXN-5341EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-13602EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-5341EC-3.2.1.21β-glucosidase
lotaustralin degradationRXN-9674EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-13603EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-9674EC-3.2.1.21β-glucosidase
taxiphyllin bioactivationRXN-13600EC-3.2.1.21β-glucosidase
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FF380432264983610
HO790301236592940
HO785819308483510
HO777739434785100
CX6352262871374230
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_012_00117.1Aquca_054_00059.1Aquca_054_00064.2Aquca_054_00061.2Aquca_054_00061.1
Aquca_054_00064.3Aquca_054_00064.1.216.582Aquca_054_00064.1.216.582Aquca_054_00060.1Aquca_054_00064.4
Aquca_054_00061.3Aquca_054_00061.4Aquca_054_00061.5Aquca_054_00061.6
Arabidopsis lyrata475147492699475148
Arabidopsis thalianaAT1G61820.1AT4G21760.1AT1G61810.1AT1G61810.3AT1G61820.3
Brachypodium distachyonBradi5g15540.1Bradi5g15527.1Bradi5g15540.3Bradi5g15540.2
Brassica rapaBra028383Bra031392Bra038756Bra013557Bra038755
Carica papayaevm.model.supercontig_198.21
Capsella rubellaCarubv10021428mCarubv10020143mCarubv10021331mCarubv10006876m
Citrus clementinaCiclev10007996mCiclev10014887mCiclev10017801m
Citrus sinensisorange1.1g009535morange1.1g014339morange1.1g045534morange1.1g016308morange1.1g012716m
orange1.1g016444morange1.1g016438morange1.1g022079m
Cucumis sativusCucsa.341820.2Cucsa.341820.1Cucsa.123340.1Cucsa.086000.1Cucsa.341820.3
Cucsa.341810.1
Eucalyptus grandisEucgr.H00071.1Eucgr.H02855.1Eucgr.E04103.1Eucgr.H02856.1Eucgr.H02856.2
Fragaria vescamrna19575.1-v1.0-hybrid
Glycine maxGlyma13g35430.2Glyma12g35125.1Glyma07g38840.1Glyma07g38850.1Glyma12g35140.2
Glyma13g35410.2Glyma13g35410.3Glyma13g35410.4
Gossypium raimondiiGorai.010G178500.1Gorai.010G178800.1Gorai.013G167400.1Gorai.013G167400.2Gorai.013G167400.4
Gorai.011G016100.1.462.724Gorai.011G016100.1.462.724Gorai.013G167400.5Gorai.013G167400.3.150.447Gorai.013G167400.3.150.447
Gorai.013G167400.6
Linum usitatissimumLus10018353Lus10007656Lus10007655Lus10032660Lus10018354
Lus10032659
Malus domesticaMDP0000140817MDP0000213598MDP0000306738MDP0000149337
Manihot esculentacassava4.1_005677mcassava4.1_032622mcassava4.1_031147mcassava4.1_026351m
Medicago truncatulaMedtr4g131800.1Medtr4g131810.1
Mimulus guttatusmgv1a004080m
Oryza sativaLOC_Os04g43360.1LOC_Os04g43410.1LOC_Os04g43390.2LOC_Os04g43360.2LOC_Os04g43390.1
LOC_Os04g43400.1LOC_Os04g43380.1
Panicum virgatumPavirv00042435mPavirv00070823mPavirv00006566mPavirv00021804mPavirv00059033m
Pavirv00006565mPavirv00036311mPavirv00010790m
Physcomitrella patensPp1s22_312V6.2Pp1s22_312V6.1
Phaseolus vulgarisPhvul.005G082900.1Phvul.005G082800.3Phvul.005G082800.2Phvul.005G082800.1Phvul.007G273800.1
Phvul.003G076700.1Phvul.006G151300.1Phvul.003G076800.1Phvul.006G151400.1Phvul.003G076700.2
Picea abiesMA_10431526g0010MA_119280g0010
Populus trichocarpaPotri.004G019800.1Potri.004G019700.1Potri.004G019500.1Potri.004G019300.1Potri.004G019300.2
Potri.001G403900.1Potri.004G019400.1
Prunus persicappa004523mppa025660mppa005194mppa017816m
Ricinus communis29842.m00362929904.m002964
Setaria italicaSi009837mSi009886mSi009882mSi009894mSi009871m
Si009850mSi010127mSi010115mSi010284mSi010346m
Si010332mSi010833m
Sorghum bicolorSb06g022460.1Sb06g022450.1Sb06g022510.1Sb06g022500.1Sb06g022410.1
Sb06g022490.1Sb06g022420.1Sb06g022385.1
Thellungiella halophilaThhalv10024134mThhalv10024920mThhalv10024911mThhalv10023411mThhalv10024896m
Vitis viniferaGSVIVT01014400001GSVIVT01012650001GSVIVT01014399001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)