y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma15g12850.2
FamilyCBM43
Protein PropertiesLength: 462 Molecular Weight: 50535.6 Isoelectric Point: 6.5016
ChromosomeChromosome/Scaffold: 15 Start: 9510329 End: 9513116
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM433744541.1e-24
  WCVANPSGDLNNVVNHMRLACSVADCTTLNYGGSCNEIGEKGNISYAFNSYYQLQMQDSRSCNFDGLGMVTFLDPSVGDCQ
GH17343530
  IGVNWGTISSHRLKPTTVVDLLRQNKISKVKLFEADSDVLRALMGSGIQVMVGIPNEMLPFLSSSPAASDLWVRQNVSAYVGRGGADIRYVAVGNEPFLS
  SYNGQYQNLIMPAILNMQQSLVKANLAGYIKLVVPCNADAYQSSALPSQGAFRPELTQIMNQLVQFLNSNGSPFVVNIYPFLSLYNNGDFPQEYAFFEGT
  THAVQDGSNVYTNAFDGNYDTLVAALTKLGYGQMPIVIGEIGWPSDGAIDANITAAKVFNQGLINHIASNKGTPLRPNAPPMDVYLFSLLDEGAKSTLPG
  NFERHWGIFSFDGQAKYPLN
Full Sequence
Protein Sequence     Length: 462     Download
MQHKTNLIIR FSGGVLLLWL LCGTLVPTMV ESAIGVNWGT ISSHRLKPTT VVDLLRQNKI    60
SKVKLFEADS DVLRALMGSG IQVMVGIPNE MLPFLSSSPA ASDLWVRQNV SAYVGRGGAD    120
IRYVAVGNEP FLSSYNGQYQ NLIMPAILNM QQSLVKANLA GYIKLVVPCN ADAYQSSALP    180
SQGAFRPELT QIMNQLVQFL NSNGSPFVVN IYPFLSLYNN GDFPQEYAFF EGTTHAVQDG    240
SNVYTNAFDG NYDTLVAALT KLGYGQMPIV IGEIGWPSDG AIDANITAAK VFNQGLINHI    300
ASNKGTPLRP NAPPMDVYLF SLLDEGAKST LPGNFERHWG IFSFDGQAKY PLNLLLGNKE    360
LKNARNVEYL PSRWCVANPS GDLNNVVNHM RLACSVADCT TLNYGGSCNE IGEKGNISYA    420
FNSYYQLQMQ DSRSCNFDGL GMVTFLDPSV GDCQFSCRRY R*                       480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5309COG53095.0e-5196345155+
pfam07983X82.0e-1637344277+
smart00768X81.0e-2837445584+
pfam00332Glyco_hydro_174.0e-7834351319+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABN08871.10314554429Glycoside hydrolase, family 17; X8 [Medicago truncatula]
EMBLCAB10499.101245530467glucanase like protein [Arabidopsis thaliana]
RefSeqNP_193451.20124553440glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
RefSeqXP_002329964.101545512449predicted protein [Populus trichocarpa]
RefSeqXP_002525026.103145523446Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ghr_A0343541306A Chain A, Crystal Structure Of A Family Gt4 Glycosyltransferase From Bacillus Anthracis Orf Ba1558.
PDB1aq0_B0343541306A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
PDB1aq0_A0343541306A Chain A, Barley 1,3-1,4-Beta-Glucanase In Monoclinic Space Group
PDB2cyg_A0343541312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_D0343542315A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
32
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GT0485663251314550
FG5285872941164090
GT0352433401114500
BX837990303333350
HO797198427324560
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_020_00610.1.369.451Aquca_007_00315.1.404.484Aquca_003_00745.1.367.446Aquca_004_00628.1.371.452Aquca_018_00224.2.330.411
Aquca_018_00224.1.360.441Aquca_004_00435.1.371.450Aquca_114_00021.1.377.459Aquca_009_00540.1.366.447Aquca_004_00629.1.368.448
Arabidopsis lyrata913356.365.447479948.337.417329810.360.439495914.362.443340560.374.456
862228.371.456893776.366.447910127.375.455496695.369.449919046.365.444
Arabidopsis thalianaAT4G31140.1.365.447AT3G24330.1.382.462AT4G17180.1.359.438AT5G58090.1.362.443AT3G04010.1.374.456
AT5G18220.1.369.454AT5G20870.1.375.457AT1G64760.2.366.447AT1G64760.1.366.447AT2G19440.1.362.443
AT5G64790.1.369.449AT5G58480.1.363.442
Brachypodium distachyonBradi3g18220.1.368.449Bradi1g56270.1.376.457Bradi1g13232.1.375.458Bradi4g15460.1.372.456Bradi2g18420.1.369.448
Bradi3g03520.1.370.451Bradi1g06050.1.372.453Bradi1g60410.1.366.447Bradi1g37160.1.368.448Bradi2g18700.1.373.454
Bradi1g65197.1.373.452
Brassica rapaBra011249.365.447Bra020389.362.443Bra002673.364.445Bra015034.380.460Bra026232.357.436
Bra024022.366.449Bra036718.366.446Bra031954.374.455Bra002143.373.458Bra006581.376.461
Bra020132.372.452Bra002646.368.447Bra037795.369.449Bra031901.369.449
Carica papayaevm.model.supercontig_23.144.370.451evm.model.supercontig_148.14.365.446evm.model.supercontig_82.42.362.443evm.model.supercontig_91.73.360.441evm.model.supercontig_51.93.361.442
evm.model.supercontig_2.377
Capsella rubellaCarubv10004695m.365.447Carubv10015679m.380.460Carubv10026324m.362.443Carubv10006187m.360.439Carubv10013602m.362.443
Carubv10013538m.374.456Carubv10003257m.369.454Carubv10000767m.376.458Carubv10028073m.344.423Carubv10027803m.369.449
Citrus clementinaCiclev10008695m.255.336Ciclev10007363m.849.930Ciclev10008079m.383.464Ciclev10014935m.405.484Ciclev10019922m.366.447
Ciclev10008127m.364.445Ciclev10023781m.368.449Ciclev10027796m.368.447
Citrus sinensisorange1.1g011636m.365.446orange1.1g047337m.373.454orange1.1g010142m.405.484orange1.1g010789m.383.464orange1.1g011532m.366.447
orange1.1g011391m.364.445orange1.1g048257m.368.449orange1.1g011468m.368.447orange1.1g045344m.523.603
Cucumis sativusCucsa.116200.1.345.426Cucsa.356270.2.280.361Cucsa.356270.1.371.452Cucsa.310710.1.368.450Cucsa.319480.1.366.445
Cucsa.012240.1.343.420Cucsa.139490.1.372.451Cucsa.340580.1.367.448Cucsa.101480.1.371.451Cucsa.367020.1.372.452
Eucalyptus grandisEucgr.C04137.1.442.523Eucgr.C02145.1.369.451Eucgr.C02156.3.364.445Eucgr.C02156.2.364.445Eucgr.C02156.1.364.445
Eucgr.D00955.1.367.446Eucgr.K01479.1.369.450Eucgr.A02084.1.366.447Eucgr.C03182.1.321.402Eucgr.I00311.1.366.446
Eucgr.J01882.1.378.457
Fragaria vescamrna29858.1-v1.0-hybrid.348.429mrna19854.1-v1.0-hybrid.364.443mrna02065.1-v1.0-hybrid.373.454mrna21072.1-v1.0-hybrid.373.454mrna15460.1-v1.0-hybrid.362.444
mrna12970.1-v1.0-hybrid.364.442mrna28204.1-v1.0-hybrid.351.430mrna21133.1-v1.0-hybrid.367.447mrna21134.1-v1.0-hybrid.351.427
Glycine maxGlyma17g12985.1.864.945Glyma04g22190.1.387.468Glyma06g23474.1.367.448Glyma04g07820.2.371.453Glyma06g07890.1.364.446
Glyma07g39950.1.365.444Glyma09g01910.2.366.445Glyma11g29410.1.372.451Glyma14g16830.1.367.449Glyma15g12850.2.374.454
Glyma15g12850.1.369.449Glyma17g29760.1.364.446Glyma16g04680.1.365.446Glyma18g06570.1.370.449Glyma05g31860.1.368.447
Glyma02g07840.1.323.404Glyma06g15240.2.375.455Glyma13g17600.1.366.449Glyma16g26860.1.370.451Glyma17g04900.1.366.450
Gossypium raimondiiGorai.010G094500.1.365.447Gorai.012G043900.1.385.464Gorai.010G068800.1.872.953Gorai.004G097500.1.363.446Gorai.007G287700.1.368.449
Gorai.013G221700.1.362.444Gorai.013G202800.1.369.450Gorai.012G009200.1.367.450Gorai.013G270800.1.366.445Gorai.008G101400.1.363.443
Gorai.011G114400.1.368.449Gorai.011G114500.1.368.448Gorai.011G114600.1.368.448
Linum usitatissimumLus10039095.369.448Lus10017740.396.477Lus10024535.376.457Lus10033082Lus10020261.370.451
Lus10002633.369.450Lus10001183.372.455Lus10043075.372.455Lus10042269.372.451Lus10040579.345.427
Lus10031098.371.452Lus10028104.345.427Lus10026387.328.407Lus10006811.396.476Lus10005788.396.476
Malus domesticaMDP0000139990.368.447MDP0000180536.371.452MDP0000247204.368.447MDP0000303770.326.407MDP0000295938.357.439
MDP0000228162.380.461MDP0000201986.368.445MDP0000785544.367.448MDP0000547069.370.451MDP0000254562.398.477
MDP0000276748.366.445MDP0000195046.369.451MDP0000896503.366.445MDP0000501865.366.445MDP0000716700.366.446
MDP0000893827.364.443MDP0000245023.356.435MDP0000159387.366.445
Manihot esculentacassava4.1_027986m.113.194cassava4.1_006709m.362.443cassava4.1_021211m.252.333cassava4.1_006647m.365.444cassava4.1_006673m.365.444
cassava4.1_006689m.367.448cassava4.1_006628m.363.444cassava4.1_006682m.365.444cassava4.1_006416m.365.446cassava4.1_006515m.368.447
cassava4.1_027475m.373.453
Medicago truncatulaMedtr3g108600.1.351.433Medtr3g031770.1.364.443Medtr2g027560.1.369.448AC233669_25.1.372.454Medtr6g032820.1.363.443
Medtr7g085390.1.368.449Medtr4g124440.1.366.449Medtr3g095050.1.373.453Medtr8g092070.1.375.455
Mimulus guttatusmgv1a006384m.342.426mgv1a004426m.410.491mgv1a004416m.411.492mgv1a005873m.345.427mgv1a005395m.368.447
mgv1a018565m.297.378mgv1a027166m.364.447mgv1a022774m.363.442mgv1a005260m.367.447mgv1a006359m.323.405
mgv1a024405m.348.428mgv1a025912m.362.442mgv1a005370m.353.435mgv1a006003m.348.428
Oryza sativaLOC_Os08g23720.1.376.455LOC_Os11g36940.1.372.456LOC_Os09g09980.1.365.444LOC_Os08g12800.1.373.454LOC_Os03g45390.1.371.454
LOC_Os03g18520.1.375.454LOC_Os02g04670.1.369.450LOC_Os03g57880.3.377.458LOC_Os03g57880.2.377.458LOC_Os03g57880.1.377.458
LOC_Os03g27980.1.372.453LOC_Os07g07340.1.365.446LOC_Os06g39060.1.371.451LOC_Os05g45860.1.291.372
Panicum virgatumPavirv00040364m.408.487Pavirv00046668m.357.435Pavirv00039130m.369.450Pavirv00010253m.324.403Pavirv00024615m.367.446
Pavirv00060764m.369.450Pavirv00034646m.293.378Pavirv00002022m.320.399Pavirv00063043m.342.423Pavirv00046422m.374.455
Pavirv00016958m.366.446Pavirv00052629m.368.448Pavirv00000796m.278.359Pavirv00064019m.314.395Pavirv00058995m.373.454
Pavirv00009799m.373.454
Physcomitrella patensPp1s54_130V6.1.380.460Pp1s14_30V6.1.377.457Pp1s197_52V6.1.377.457Pp1s27_327V6.1.372.450Pp1s162_17V6.2.371.449
Pp1s162_17V6.1.371.449Pp1s157_11V6.1.367.444Pp1s109_183V6.1
Phaseolus vulgarisPhvul.003G176600.1.897.978Phvul.009G200400.1.369.456Phvul.009G099800.1.131.213Phvul.001G057100.2.280.362Phvul.001G057100.1.367.449
Phvul.006G135700.1.367.446Phvul.003G088600.1.368.447Phvul.006G072800.1.369.448Phvul.004G079100.1.367.448Phvul.001G109400.1.365.446
Phvul.009G138800.1.377.457Phvul.003G126100.1.366.450Phvul.002G266100.1.402.482
Picea abiesMA_17339g0040.332.415MA_43291g0010.369.450MA_10437110g0020.368.449MA_721956g0010
Populus trichocarpaPotri.018G077000.1.373.454Potri.018G072300.1.373.454Potri.016G002800.3.368.447Potri.016G002800.1.368.447Potri.006G002100.1.368.447
Potri.018G000900.1.382.465Potri.006G216700.1.367.448Potri.018G150400.1.364.445Potri.006G280700.2.342.425Potri.006G280700.1.378.461
Potri.006G080600.2.364.446Potri.006G080600.1.364.446Potri.019G032900.3.266.347Potri.019G032900.2.367.448Potri.019G032900.1.395.476
Potri.013G059700.1.367.448Potri.009G076500.1.365.444Potri.016G002800.2.368.437Potri.007G078900.1.372.452Potri.002G000700.1
Prunus persicappa004814m.368.450ppa004783m.373.452ppa004964m.364.445ppa017632m.369.450ppa004643m.366.444
ppa005641m.338.419ppb004066m.366.445ppa017706m.346.425ppa018453m.367.446
Ricinus communis28226.m000880.369.45129836.m000569.365.44429848.m004686.373.45429739.m003664.380.46129777.m000270.363.445
29950.m001151.367.44827758.m000328.369.44930156.m001714.278.357
Setaria italicaSi013645m.369.450Si026278m.372.457Si017029m.370.451Si035350m.378.459Si029637m.367.446
Si040250m.373.452Si013637m.367.446Si035361m.375.456Si029650m.370.451Si008675m.367.447
Si035326m.375.456Si024796m.377.458
Selaginella moellendorffii171231.381.45832959.349.42889756.387.467231117.357.43886140.369.449
236210.379.458267465.357.437
Sorghum bicolorSb01g012900.1.377.458Sb02g017290.1.368.447Sb04g003170.2.369.450Sb04g003170.1.369.450Sb02g003910.1.373.454
Sb07g006340.1.374.455Sb05g022490.1.392.464Sb01g033200.1.373.454Sb01g005610.1.376.459Sb10g022940.1.380.460
Sb09g026690.1.372.453Sb01g038220.1.372.451
Thellungiella halophilaThhalv10024947m.357.436Thhalv10025047m.365.447Thhalv10013422m.362.443Thhalv10002822m.427.507Thhalv10020592m.374.456
Thhalv10015448m.371.456Thhalv10022665m.366.447Thhalv10013340m.373.454Thhalv10012621m.365.444Thhalv10004092m.369.449
Vitis viniferaGSVIVT01002584001.290.369GSVIVT01015435001.864.944GSVIVT01034245001.364.445GSVIVT01033384001.367.448GSVIVT01014995001.363.444
GSVIVT01030073001.368.447
Zea maysAC217887.3_FGT004.373.454AC159612.1_FGT007.337.418
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)