y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma15g13250.1
FamilyGT65
Protein PropertiesLength: 444 Molecular Weight: 50420.3 Isoelectric Point: 7.0946
ChromosomeChromosome/Scaffold: 15 Start: 9889087 End: 9891823
DescriptionO-fucosyltransferase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT65763910
  GLNNQKIAFARACLTARMLNRTLLMPSLSASLFYKEIDLLQPISFDKVFQFEKFNALCRGFVRLGCYSDVLNRTEVLKMEKGSGRRWTVERDLAQLKEHS
  KGSFDDYEVIRIVGKNPFLWHDHWPVKDYARVFECLDLTEEIAKEADRIVSRIRAVGREVTGNTEAVEVENNIITSDGSSFQPLPFVAVHMRIEIDWMIH
  CKNLEQRLNTNQICSGKKEIVERVGNIAGLKTPVVVYLAVADKLLNNSSSILDDWEEGFLPFEKKRLGVDGIYKKYPYLIQSAIDYEVCLRADIFVGNSF
  STFSSLIALERTQKMI
Full Sequence
Protein Sequence     Length: 444     Download
MEVLSKFLVG PLHSITSKCM VLLVTVLILR ALLFPSFPGF DGIEWGNLVC IRTPLLNSDF    60
GIQQDKFLEV PQLVWGLNNQ KIAFARACLT ARMLNRTLLM PSLSASLFYK EIDLLQPISF    120
DKVFQFEKFN ALCRGFVRLG CYSDVLNRTE VLKMEKGSGR RWTVERDLAQ LKEHSKGSFD    180
DYEVIRIVGK NPFLWHDHWP VKDYARVFEC LDLTEEIAKE ADRIVSRIRA VGREVTGNTE    240
AVEVENNIIT SDGSSFQPLP FVAVHMRIEI DWMIHCKNLE QRLNTNQICS GKKEIVERVG    300
NIAGLKTPVV VYLAVADKLL NNSSSILDDW EEGFLPFEKK RLGVDGIYKK YPYLIQSAID    360
YEVCLRADIF VGNSFSTFSS LIALERTQKM IRINVTNMCG ENVRWPSYAY NIPGESNGPM    420
RWVTNMSESS LQAISYGTNH ISC*                                           480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd11296O-FucT_like0.00036710135+
cd11302O-FucT-11.0e-5260386146+
cd11299O-FucT_plant4.0e-1776387332+
cd11296O-FucT_like2.0e-22197387196+
pfam10250O-FucT1.0e-4176387343+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_187183.301444316442unknown protein [Arabidopsis thaliana]
RefSeqXP_002273827.10154431427PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002321799.10934431347predicted protein [Populus trichocarpa]
RefSeqXP_002332132.10934431347predicted protein [Populus trichocarpa]
RefSeqXP_002531235.101244317446conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3zy6_A0.000000076038620344A Chain A, Crystal Structure Of A Class V Chitinase From Arabidopsis Thaliana
PDB3zy5_A0.000000076038620344A Chain A, Crystal Structure Of A Class V Chitinase From Arabidopsis Thaliana
PDB3zy4_A0.000000076038620344A Chain A, Crystal Structure Of A Class V Chitinase From Arabidopsis Thaliana
PDB3zy3_B0.000000076038620344A Chain A, Crystal Structure Of A Class V Chitinase From Arabidopsis Thaliana
PDB3zy3_A0.000000076038620344A Chain A, Crystal Structure Of A Class V Chitinase From Arabidopsis Thaliana
Transmembrane Domains
StartEnd
729
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DW5174702701754440
FK000039232442750
DW5173972531754270
HO0169931922184090
GO8579223081364430
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_035_00086.1
Arabidopsis lyrata477820
Arabidopsis thalianaAT3G05320.1
Brachypodium distachyonBradi3g05130.1
Brassica rapaBra040646.99.283Bra040646.99.283
Capsella rubellaCarubv10013700mCarubv10013656m
Citrus clementinaCiclev10015216m
Citrus sinensisorange1.1g013043m
Cucumis sativusCucsa.236440.1
Eucalyptus grandisEucgr.H03600.1
Fragaria vescamrna20066.1-v1.0-hybrid
Glycine maxGlyma07g34965.1.189.378Glyma07g34965.1.189.378Glyma07g34965.2.189.378Glyma20g02800.2Glyma20g02800.3
Glyma09g02350.2Glyma07g34965.2.189.378Glyma09g02350.3Glyma07g34965.3.189.378Glyma07g34965.3.189.378
Glyma07g34965.1.70.189Glyma07g34965.1.70.189Glyma07g34965.2.70.189Glyma07g34965.2.70.189Glyma07g34965.3.70.189
Glyma07g34965.3.70.189
Gossypium raimondiiGorai.009G150500.1.203.398Gorai.011G050000.1Gorai.011G049800.1Gorai.010G169400.1Gorai.010G169400.2
Gorai.009G150500.1.84.201Gorai.009G150500.1.84.201Gorai.009G150500.1.203.398
Linum usitatissimumLus10018291Lus10040618
Malus domesticaMDP0000794968.202.395MDP0000218405.202.395MDP0000218405.202.395MDP0000794968.202.395MDP0000218405.83.200
MDP0000218405.83.200MDP0000794968.83.200MDP0000794968.83.200MDP0000292513
Manihot esculentacassava4.1_007711m
Medicago truncatulaMedtr4g083590.1Medtr2g028900.1
Mimulus guttatusmgv1a024556m.157.260mgv1a024556m.157.260mgv1a010727m
Oryza sativaLOC_Os02g07200.1LOC_Os02g07200.3LOC_Os02g07200.2
Panicum virgatumPavirv00064034mPavirv00047509m
Phaseolus vulgarisPhvul.006G131800.1.76.195Phvul.006G131600.2Phvul.006G131600.1Phvul.006G131800.1.76.195Phvul.006G131800.1.195.389
Phvul.006G131800.1.195.389
Picea abiesMA_458283g0010MA_730174g0010MA_10435476g0010
Populus trichocarpaPotri.015G117500.1Potri.012G118800.1
Prunus persicappa005601m
Ricinus communis30109.m000167
Setaria italicaSi020158m
Selaginella moellendorffii130392.157.337130392.157.337130392.42.158130392.42.158
Sorghum bicolorSb04g004590.1
Thellungiella halophilaThhalv10020752m.197.381Thhalv10020752m.197.381Thhalv10020752m.78.198Thhalv10020752m.78.198
Vitis viniferaGSVIVT01026258001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny