y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma15g13620.1
FamilyGH3
Protein PropertiesLength: 662 Molecular Weight: 72069.8 Isoelectric Point: 6.583
ChromosomeChromosome/Scaffold: 15 Start: 10209889 End: 10217518
DescriptionGlycosyl hydrolase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH31083430
  LESRLGIPMIYGIDAVHGHNNVYNATIFPHNVGLGCTRDPNLAQRIGAATALEVRATGIPYVFAPCIAVCRDPRWGRCYESYSEDPKIVQEMTEIIPGLQ
  GSIPANSRKGFPYVGGKTKVAACAKHFVGDGGTTKGINENNTVIDWHGLLSIHMPAYSDSIIKGVSTVMVSYSSWNGVRMHANRDLVTGFLKNTLKFKGF
  VISDWQGIDRLTSPPSSNYTYSVQASIEAGVDMVMV
Full Sequence
Protein Sequence     Length: 662     Download
MSRALVHLLG VLWLCCWLAS TGESQIEYLR YKDPKQPVPT RVRDLMSRMT LEEKIGQMVQ    60
IDRSVANANV MKTSFIGSVL SGGGSEPLPR ATAEDWVNMI NDFQKGALES RLGIPMIYGI    120
DAVHGHNNVY NATIFPHNVG LGCTRDPNLA QRIGAATALE VRATGIPYVF APCIAVCRDP    180
RWGRCYESYS EDPKIVQEMT EIIPGLQGSI PANSRKGFPY VGGKTKVAAC AKHFVGDGGT    240
TKGINENNTV IDWHGLLSIH MPAYSDSIIK GVSTVMVSYS SWNGVRMHAN RDLVTGFLKN    300
TLKFKGFVIS DWQGIDRLTS PPSSNYTYSV QASIEAGVDM VMVPFEYGKF IQDLTLLVKS    360
NIIPMERIDD AVERILLVKF TMGLFENPLA DTSLVNELGS QEHRDLAREA VRKSLVLLKN    420
GKNESASLLP LPKKVPKILV AGSHADNLGY QCGGWTIKWQ GFSGNSDTRG TTILNAIKSA    480
VDTSTEVVFR DNPDNEFVKS NNFEYAIVVV GEPPYAETAG DSTTLTMMES GPNVINNVCG    540
TVKCVVVIIS GRPIVIEPYI SSIDALVAAW LPGTEGQGMT DVLFGDYGFT GKLARTWFKS    600
VDQLPMNVGD PHYDPLFPFG FGLTTESVKD LVARSTSAAV GARACIFTII VTLIISLYLP    660
G*                                                                   720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03080PLN030803.0e-3437607626+
pfam01915Glyco_hydro_3_C2.0e-45415624229+
PRK15098PRK150982.0e-7742643681+
COG1472BglX4.0e-8449482447+
pfam00933Glyco_hydro_32.0e-9250376331+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK95015.1016311626unknown [Populus trichocarpa]
RefSeqNP_680141.2016591658glycosyl hydrolase family 3 protein [Arabidopsis thaliana]
RefSeqXP_002262992.102765924653PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002325849.102463111613predicted protein [Populus trichocarpa]
RefSeqXP_002514453.1016511646Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1j8v_A0276291603A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid
PDB1iex_A0276291603A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid
PDB1iew_A0276291603A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid
PDB1iev_A0276291603A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid
PDB1ieq_A0276291603A Chain A, Recombinant Horseradish Peroxidase Phe209ser Complex With Benzhydroxamic Acid
Metabolic Pathways
Pathway NameReactionECProtein Name
coumarin biosynthesis (via 2-coumarate)RXN-8036EC-3.2.1.21β-glucosidase
linamarin degradationRXN-5341EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-13602EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-5341EC-3.2.1.21β-glucosidase
lotaustralin degradationRXN-9674EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-13603EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-9674EC-3.2.1.21β-glucosidase
taxiphyllin bioactivationRXN-13600EC-3.2.1.21β-glucosidase
Transmembrane Domains
StartEnd
638660
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO784016427775030
FN998758327754010
FN998446320753940
FN998735316753900
HO7840165128780.0000000002
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00600.1Aquca_009_00598.3Aquca_009_00598.2Aquca_009_00598.1Aquca_009_00603.1
Aquca_009_00596.1Aquca_009_00601.1Aquca_009_00602.1Aquca_009_00735.2Aquca_009_00735.1
Aquca_009_00596.4Aquca_009_00596.3Aquca_009_00596.2Aquca_009_00596.5Aquca_009_00735.3
Aquca_009_00601.2
Arabidopsis lyrata485082489005487274489003485079
323329486769485080
Arabidopsis thalianaAT5G20950.2AT5G20950.1AT5G04885.1AT5G20940.1AT3G47000.1
AT3G47010.2AT3G47010.1AT3G47050.2AT3G47050.1AT3G62710.1
AT3G47040.1AT3G47040.2
Brachypodium distachyonBradi1g08550.2Bradi1g08570.2Bradi1g08570.1Bradi2g51280.1Bradi1g08560.1
Bradi1g08580.1Bradi2g23720.1
Brassica rapaBra005825Bra020139Bra009417Bra003508Bra018177
Bra014397Bra002346Bra018172Bra006587Bra018171
Bra033795
Carica papayaevm.model.supercontig_103.89evm.model.supercontig_51.147evm.model.supercontig_103.88evm.model.supercontig_51.146evm.model.supercontig_103.83
evm.model.supercontig_112.57evm.model.supercontig_103.85
Capsella rubellaCarubv10016857mCarubv10000466mCarubv10000396mCarubv10002603mCarubv10016864m
Carubv10019506mCarubv10016871mCarubv10018993m
Citrus clementinaCiclev10019305mCiclev10030270mCiclev10018271mCiclev10017853mCiclev10015118m
Ciclev10014767mCiclev10014537mCiclev10028019mCiclev10028018mCiclev10028048m
Citrus sinensisorange1.1g038523morange1.1g036635morange1.1g006872morange1.1g013915morange1.1g013894m
orange1.1g013886morange1.1g040637m
Cucumis sativusCucsa.340290.1Cucsa.282900.1Cucsa.111760.1Cucsa.340300.1Cucsa.356980.1
Cucsa.146890.1Cucsa.146880.2Cucsa.146880.1Cucsa.146890.3Cucsa.146890.2
Cucsa.340290.2Cucsa.109190.1
Eucalyptus grandisEucgr.J00606.1Eucgr.J00608.1Eucgr.A02118.1Eucgr.J00609.1Eucgr.G02657.1
Eucgr.J00604.1Eucgr.J00603.1Eucgr.J00605.1Eucgr.B02287.1Eucgr.B02276.1
Eucgr.A02116.1Eucgr.J00607.1
Fragaria vescamrna03614.1-v1.0-hybridmrna07689.1-v1.0-hybridmrna07690.1-v1.0-hybridmrna07985.1-v1.0-hybridmrna22463.1-v1.0-hybrid
mrna00353.1-v1.0-hybridmrna22192.1-v1.0-hybrid
Glycine maxGlyma19g29050.1Glyma10g15980.1Glyma17g24410.1Glyma09g02731.2Glyma09g02731.1
Glyma02g43990.2Glyma02g43990.1Glyma14g04940.2Glyma14g04940.1Glyma02g33550.1
Glyma16g04330.1Glyma19g29060.1Glyma16g04340.1Glyma02g39010.1Glyma11g22940.2
Glyma11g22940.1Glyma02g43990.3Glyma14g37070.1Glyma18g07260.2
Gossypium raimondiiGorai.009G081100.1Gorai.006G118100.3Gorai.006G118100.2Gorai.006G118100.1Gorai.009G301800.2
Gorai.009G301800.1Gorai.013G114800.5Gorai.013G114800.4Gorai.013G114800.3Gorai.013G114800.2
Gorai.013G114800.11Gorai.013G114800.10Gorai.013G114800.1Gorai.007G260100.2Gorai.007G260100.1
Gorai.007G260000.1Gorai.013G260700.3Gorai.013G260700.2Gorai.013G260700.1Gorai.002G219500.1
Gorai.009G093600.1Gorai.013G114800.6Gorai.013G114800.8Gorai.013G114800.7Gorai.013G260700.4
Gorai.013G114800.9Gorai.013G114800.12Gorai.001G127700.1Gorai.001G127600.1
Linum usitatissimumLus10001151Lus10013646Lus10010656Lus10033393Lus10005706
Lus10010657Lus10005871Lus10001200.86.321Lus10013390Lus10022413
Lus10018102Lus10008432Lus10023604Lus10013388Lus10008434
Lus10043457Lus10034848Lus10013647
Malus domesticaMDP0000765919MDP0000196385MDP0000062066MDP0000272685MDP0000194876
MDP0000119414MDP0000140449MDP0000218589MDP0000191983MDP0000171861
MDP0000153761MDP0000121876MDP0000154790MDP0000190086MDP0000243329
MDP0000552093MDP0000163344MDP0000119413MDP0000235035MDP0000302379
Manihot esculentacassava4.1_033854mcassava4.1_024895mcassava4.1_030227mcassava4.1_003201mcassava4.1_003199m
cassava4.1_003582mcassava4.1_024363m
Medicago truncatulaMedtr3g079750.1Medtr2g030000.1Medtr7g086030.1Medtr5g069800.1Medtr7g086010.1
Medtr5g069740.1AC235673_11.1
Mimulus guttatusmgv1a002814mmgv1a003439mmgv1a002476mmgv1a002879mmgv1a002782m
mgv1a002845mmgv1a019891mmgv1a020896mmgv1a003116mmgv1a003210m
Oryza sativaLOC_Os03g53800.5LOC_Os03g53800.4LOC_Os03g53800.3LOC_Os03g53800.2LOC_Os03g53800.1
LOC_Os03g53860.5LOC_Os03g53860.4LOC_Os03g53860.3LOC_Os03g53860.2LOC_Os03g53860.1
LOC_Os02g03870.1LOC_Os01g56510.5LOC_Os01g56510.4LOC_Os01g56510.3LOC_Os01g56510.2
LOC_Os01g56510.1LOC_Os03g53790.1LOC_Os05g37700.1LOC_Os05g37700.2
Panicum virgatumPavirv00044084mPavirv00044083mPavirv00044082mPavirv00057654mPavirv00000883m
Pavirv00015776mPavirv00021236mPavirv00021235mPavirv00001262mPavirv00040732m
Pavirv00029174mPavirv00022627mPavirv00015364mPavirv00023155mPavirv00060136m
Pavirv00060135mPavirv00023191mPavirv00015460mPavirv00012515mPavirv00047960m
Pavirv00013835m
Physcomitrella patensPp1s1821_1V6.1Pp1s217_8V6.1Pp1s309_65V6.2Pp1s309_65V6.1Pp1s49_195V6.1
Phaseolus vulgarisPhvul.007G250300.1Phvul.004G050500.1Phvul.006G128800.1Phvul.008G210100.1Phvul.001G112700.1
Phvul.006G065600.1Phvul.001G112600.2Phvul.001G112600.1
Picea abiesMA_10437038g0010MA_56211g0010MA_41345g0010MA_10429527g0010MA_10435456g0010
MA_10247978g0010MA_10435456g0020MA_8496645g0010MA_10435456g0030
Populus trichocarpaPotri.019G037400.1Potri.013G055600.2Potri.013G055600.1Potri.008G013500.1Potri.019G037400.2
Potri.008G013700.1Potri.009G153900.3Potri.009G153900.1Potri.009G153900.2Potri.009G042800.2
Potri.009G042800.1Potri.009G154000.1Potri.009G154800.1Potri.009G153900.4Potri.005G059200.1
Prunus persicappa014605mppa020836mppa014607mppa002559mppa015239m
ppa002894mppa003012mppa025914mppa014895mppa026252m
ppa006354mppa018735mppa022452mppa021476m
Ricinus communis43378.m00001329976.m00048930072.m00098129852.m00202029976.m000487
29681.m00129734040.m000025
Setaria italicaSi034693mSi034691mSi034690mSi034605mSi034551m
Si034710mSi034709mSi034708mSi034705mSi034703m
Si020199mSi000575mSi020102mSi019228mSi019105m
Si004089mSi040033mSi024819mSi021490mSi035613m
Selaginella moellendorffii15726074114
Sorghum bicolorSb01g008040.3Sb01g008040.2Sb01g008040.1Sb01g008030.5Sb01g008030.4
Sb01g008030.3Sb01g008030.2Sb01g008030.1Sb03g035970.1Sb04g002570.1
Sb04g002560.1Sb04g002580.1Sb01g008050.1Sb09g022050.2Sb09g022050.1
Thellungiella halophilaThhalv10012965mThhalv10012964mThhalv10012963mThhalv10012900mThhalv10015493m
Thhalv10010277mThhalv10010212mThhalv10005832mThhalv10010213mThhalv10010219m
Vitis viniferaGSVIVT01012185001GSVIVT01037543001GSVIVT01023452001GSVIVT01023455001GSVIVT01022483001
GSVIVT01034613001GSVIVT01037542001GSVIVT01024793001GSVIVT01037547001GSVIVT01037546001
Zea maysAC197578.4_FGT001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)