y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma15g14090.2
FamilyAA7
Protein PropertiesLength: 493 Molecular Weight: 54848.5 Isoelectric Point: 10.2343
ChromosomeChromosome/Scaffold: 15 Start: 10629110 End: 10635521
DescriptionFAD-binding Berberine family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA71122470
  LGGIIVNVKNEVAMVQAGATLGEVYYRIWEKSKVLGFPAGVCPTVDVGGHISGGGYDNMLRKHGLSVDNVIDAQIVDVKGNLLNRKTMGEDLFWAIRGGG
  GASFGVILSFTFKLVPVPKTVTVFRVEKTLEENATD
Full Sequence
Protein Sequence     Length: 493     Download
MAKPSLAYLF AAFLLLIVSI SLSKPSPKSS LYDTFLHCFT QHTNSSTQFS NIVFPQSNPK    60
FPFVTQNYIR NARFNTPLTQ KLLLIVTPQV ESHVQATVIC AKSVNSQPNI NLGGIIVNVK    120
NEVAMVQAGA TLGEVYYRIW EKSKVLGFPA GVCPTVDVGG HISGGGYDNM LRKHGLSVDN    180
VIDAQIVDVK GNLLNRKTMG EDLFWAIRGG GGASFGVILS FTFKLVPVPK TVTVFRVEKT    240
LEENATDFVL LFMRLLLQPV SSKVVKGGNT IRASVVALFL GGANEVVPIL AKQFPLLGLR    300
KENCTEVSWM DSVLWWDDDK SLKNGAKPET LLDRHANTAD FLKRKSDYVQ KAIPREGLEF    360
IWKRMIELGK TGLVFNPYGR KMAQGNLFKV QYSVTWKDPS LAAAQNFLNQ ARKLYSYMTP    420
FVSKNPRSAF LNYRDLDIGV NNFRKNSFQE GEVYGAKYFN GNFQRLIKVK TVVDSTNFFR    480
NEQSIPLAPS KA*                                                       540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02441PLN024410.00815823781+
pfam01565FAD_binding_42.0e-1283195137+
pfam08031BBE1.0e-1342948658+
COG0277GlcD3.0e-1662488468+
Gene Ontology
GO TermDescription
GO:0008762UDP-N-acetylmuramate dehydrogenase activity
GO:0016491oxidoreductase activity
GO:0050660flavin adenine dinucleotide binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002267223.103048633529PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002299028.1014921536predicted protein [Populus trichocarpa]
RefSeqXP_002317087.1014921535predicted protein [Populus trichocarpa]
RefSeqXP_002523157.102949234539Reticuline oxidase precursor, putative [Ricinus communis]
RefSeqXP_002523158.102949234539Reticuline oxidase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3vte_A0334895514A Chain A, Crystal Structure Of Tetrahydrocannabinolic Acid Synthase From Cannabis Sativa
PDB3tsj_B0274863494A Chain A, Crystal Structure Of Tetrahydrocannabinolic Acid Synthase From Cannabis Sativa
PDB3tsj_A0274863494A Chain A, Crystal Structure Of Tetrahydrocannabinolic Acid Synthase From Cannabis Sativa
PDB3tsh_A0274863494A Chain A, Crystal Structure Of Phl P 4, A Grass Pollen Allergen With Glucose Dehydrogenase Activity
PDB4dns_B03548613494A Chain A, Crystal Structure Of Bermuda Grass Isoallergen Bg60 Provides Insight Into The Various Cross-Allergenicity Of The Pollen Group 4 Allergens
Metabolic Pathways
Pathway NameReactionECProtein Name
cannabinoid biosynthesisRXN-7854EC-1.21.3tetrahydrocannabinolic acid synthase
Transmembrane Domains
StartEnd
522
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7811533511694930
DY2754523941204860
FC8963933121994860
HO777438508324870
DY275452951132040.0007
Orthologous Group
SpeciesID
Arabidopsis lyrata880898
Brachypodium distachyonBradi3g35230.1Bradi5g02950.1
Brassica rapaBra027552
Citrus sinensisorange1.1g037020morange1.1g019526m
Eucalyptus grandisEucgr.D01624.1
Linum usitatissimumLus10031080Lus10023368
Manihot esculentacassava4.1_008891m
Medicago truncatulaAC233560_1010.1.205.310AC233560_1010.1.205.310
Oryza sativaLOC_Os10g21690.1
Panicum virgatumPavirv00001111m
Phaseolus vulgarisPhvul.002G201300.1
Setaria italicaSi006831m
Sorghum bicolorSb10g021666.1
Vitis viniferaGSVIVT01021720001.517.648GSVIVT01020745001GSVIVT01021720001.517.648GSVIVT01015803001GSVIVT01021734001
GSVIVT01021720001.63.170GSVIVT01021720001.63.170GSVIVT01021736001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny