y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma15g15820.1
FamilyGT34
Protein PropertiesLength: 268 Molecular Weight: 30690 Isoelectric Point: 6.3975
ChromosomeChromosome/Scaffold: 15 Start: 12156728 End: 12157886
Descriptionxylosyltransferase 1
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT341422660
  KPRVLLVTGSSPKPCENPVGDHYLVKSIKNKIDYCRVHGIEIFYNMALLDAEMAGFWAKLPLIRKLLLSHPEVEFLWWMDSDAMFTDMAFEVPWERYKDS
  NFVMHGWNEMVYDEKNWIGLTLGVF
Full Sequence
Protein Sequence     Length: 268     Download
MLERCLGPRR VRQMQRGCRH STVTFLCLFL TLVVLRGTIG AGKFGTPEQD FNEIRHHLSA    60
ARARRVLEET KPESSSESNS NSNNYATFDL SKILVDEPPS DDEKPNPNAP YTLGPKISNW    120
DEQRASWLSN NPDYPNFIGP NKPRVLLVTG SSPKPCENPV GDHYLVKSIK NKIDYCRVHG    180
IEIFYNMALL DAEMAGFWAK LPLIRKLLLS HPEVEFLWWM DSDAMFTDMA FEVPWERYKD    240
SNFVMHGWNE MVYDEKNWIG LTLGVFC*                                       300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam05637Glyco_transf_342.0e-48141266150+
PLN03181PLN031812.0e-73106266161+
PLN03182PLN031826.0e-1301266270+
Gene Ontology
GO TermDescription
GO:0016021integral to membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAI11449.1012661264alpha-1,6-xylosyltransferase [Vitis vinifera]
EMBLCAN77730.1012661264hypothetical protein [Vitis vinifera]
RefSeqXP_002263821.1012661266PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002273887.1012661264PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002516919.1012661274Xyloglucan 6-xylosyltransferase, putative [Ricinus communis]
Metabolic Pathways
Pathway NameReactionECProtein Name
xyloglucan biosynthesisRXN-12415EC-2.4.2.39xyloglucan 6-xylosyltransferase
xyloglucan biosynthesisRXN-9461EC-2.4.2.39xyloglucan 6-xylosyltransferase
Transmembrane Domains
StartEnd
2140
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CB89105826152610
DK50549527812660
DK48248126712580
FC88957127012660
DY28686727012660
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00205.1Aquca_002_00702.1Aquca_060_00047.1
Arabidopsis lyrata490316312817907847487607476571
912562481152
Arabidopsis thalianaAT4G02500.1AT1G18690.1AT3G62720.2AT3G62720.1AT1G74380.1
AT5G07720.1AT2G22900.1AT4G37690.1AT4G38310.1
Brachypodium distachyonBradi3g44800.1Bradi4g42610.1Bradi1g64950.1Bradi1g64570.1Bradi1g64560.1
Bradi4g16670.1Bradi3g56507.1
Brassica rapaBra018545Bra036262Bra000877Bra014396Bra009305
Bra015915Bra007696Bra003804Bra025677Bra039938
Bra017847Bra008146
Carica papayaevm.model.supercontig_9.211evm.model.supercontig_13.296evm.model.supercontig_103.100
Capsella rubellaCarubv10000917mCarubv10000915mCarubv10017185mCarubv10009116mCarubv10000835m
Carubv10020269mCarubv10023195m
Chlamydomonas reinhardtiiCre01.g031650.t1.3Cre11.g474750.t1.3
Citrus clementinaCiclev10004948mCiclev10020086mCiclev10020012mCiclev10025585m
Citrus sinensisorange1.1g047753morange1.1g012705morange1.1g012077morange1.1g045999m
Cucumis sativusCucsa.253090.1Cucsa.205700.1Cucsa.103300.1Cucsa.197880.1Cucsa.197890.1
Cucsa.318300.1
Eucalyptus grandisEucgr.B01313.1Eucgr.B00540.1Eucgr.I00693.1
Fragaria vescamrna06894.1-v1.0-hybridmrna10573.1-v1.0-hybridmrna26058.1-v1.0-hybridmrna05784.1-v1.0-hybridmrna10438.1-v1.0-hybrid
Glycine maxGlyma19g39760.1Glyma09g05010.2Glyma09g05010.1Glyma05g00860.1Glyma17g11060.1
Glyma03g37150.1Glyma11g05020.1Glyma01g40270.1Glyma05g22680.1
Gossypium raimondiiGorai.005G060400.1Gorai.N024600.1Gorai.004G052700.1Gorai.007G128800.1Gorai.003G098400.1
Gorai.008G195000.1Gorai.008G084100.5Gorai.008G084100.4Gorai.008G084100.3Gorai.008G084100.2
Gorai.003G031400.1Gorai.007G224800.1Gorai.008G084100.1.129.222Gorai.008G084100.1.129.222Gorai.008G084100.1.223.370
Gorai.008G084100.1.223.370
Linum usitatissimumLus10037519Lus10002870Lus10037516Lus10021631Lus10000563
Lus10019076Lus10015721Lus10037514Lus10011550Lus10019265
Lus10037520
Malus domesticaMDP0000306139MDP0000628100MDP0000512420MDP0000213291MDP0000374557
MDP0000267641MDP0000197595MDP0000173397MDP0000186772MDP0000871602
MDP0000243498.466.743MDP0000243498.466.743MDP0000186170MDP0000860874MDP0000146168
MDP0000124832MDP0000243498.109.299MDP0000243498.109.299MDP0000186172MDP0000129630
MDP0000162905
Manihot esculentacassava4.1_034186mcassava4.1_007254mcassava4.1_007448mcassava4.1_026770mcassava4.1_027503m
cassava4.1_028965m
Medicago truncatulaMedtr8g058450.1Medtr4g119880.1Medtr5g015260.1Medtr4g097230.1Medtr4g097240.1
Mimulus guttatusmgv1a027105mmgv1a027073mmgv1a003740mmgv1a006132mmgv1a006038m
mgv1a006348mmgv1a018855m.124.226mgv1a018855m.124.226mgv1a018855m.226.387mgv1a018855m.226.387
Oryza sativaLOC_Os02g32750.2LOC_Os02g32750.1LOC_Os12g05380.1LOC_Os03g18820.2LOC_Os03g18820.1
LOC_Os03g19310.1LOC_Os03g19330.1LOC_Os11g34390.1LOC_Os02g49140.1
Panicum virgatumPavirv00048309mPavirv00046900mPavirv00067397mPavirv00021533mPavirv00058176m
Pavirv00041348mPavirv00058240mPavirv00025200mPavirv00028711mPavirv00058241m
Pavirv00058175mPavirv00005933mPavirv00063789mPavirv00028712mPavirv00048487m
Pavirv00023312mPavirv00024996mPavirv00027797m.46.148Pavirv00027797m.46.148Pavirv00040967m
Pavirv00027797m.155.303Pavirv00027797m.155.303
Physcomitrella patensPp1s210_35V6.2Pp1s210_35V6.1Pp1s17_404V6.1Pp1s216_58V6.1Pp1s151_51V6.1
Pp1s20_331V6.3Pp1s20_331V6.2Pp1s20_331V6.1Pp1s74_206V6.2Pp1s74_206V6.1
Pp1s185_87V6.1Pp1s71_269V6.1Pp1s52_88V6.1Pp1s298_59V6.3Pp1s298_59V6.2
Pp1s298_59V6.1Pp1s91_136V6.1Pp1s118_95V6.1Pp1s143_13V6.1Pp1s20_391V6.1
Pp1s167_73V6.2Pp1s167_73V6.1Pp1s17_17V6.1Pp1s100_136V6.1Pp1s35_169V6.1
Pp1s96_121V6.1Pp1s20_331V6.4Pp1s85_95V6.1.231.346Pp1s85_95V6.1.231.346Pp1s85_95V6.1.139.224
Pp1s85_95V6.1.139.224Pp1s42_153V6.1Pp1s31_396V6.1
Phaseolus vulgarisPhvul.001G206000.2Phvul.001G206000.1Phvul.009G248100.1Phvul.003G188200.1Phvul.002G009900.1
Picea abiesMA_5873g0010MA_10428947g0010MA_48841g0010MA_101873g0010MA_53390g0010
MA_123211g0010MA_124049g0020
Populus trichocarpaPotri.010G025300.1Potri.008G208000.1Potri.010G025100.1Potri.015G061800.3Potri.015G061800.1
Potri.012G068300.1Potri.007G005900.2Potri.007G005900.1Potri.014G008800.2Potri.014G008800.1
Potri.014G006100.1Potri.015G061800.2
Prunus persicappa005690mppa005479mppa005681mppa017391mppa019851m
ppa006622m
Ricinus communis29726.m00404130138.m00403930169.m00636729661.m000937
Setaria italicaSi017087mSi035653mSi012801mSi028282mSi038774m
Si027422mSi009922mSi038629mSi039147mSi027576m
Si028029mSi027617mSi026397m.111.200Si026397m.111.200Si026397m.210.375
Si026397m.210.375Si026788mSi030580m
Selaginella moellendorffii11214313118341469088477112156
9707764648411111
Sorghum bicolorSb04g021570.1Sb08g003090.1Sb03g005110.1Sb01g038000.1Sb01g037530.1
Sb08g003080.1Sb01g037540.1Sb05g020910.1Sb05g020930.1Sb04g029500.1
Sb05g020911.1Sb02g009950.1
Thellungiella halophilaThhalv10028641mThhalv10007657mThhalv10018522mThhalv10005949mThhalv10013509m
Thhalv10000162mThhalv10027092m
Vitis viniferaGSVIVT01017760001GSVIVT01007963001GSVIVT01027978001
Volvox carteriVocar20004494mVocar20014473m
Zea maysAC186147.3_FGT008
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)