y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma15g16141.1
FamilyCE8
Protein PropertiesLength: 369 Molecular Weight: 40486.7 Isoelectric Point: 6.3086
ChromosomeChromosome/Scaffold: 15 Start: 12446725 End: 12454208
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE8863100
  AIVTQDATSQFATLSDALKTVPPKNVIVGKDMTHVTVIGDGPMYKDEIHRELKLECKIYNLLCELFVGERLQASASSPSQTSSAPVNAANFMAKDVGFEN
  TAGAEKHQAVALRVTADQAMFYNCQMDVFQDTPYTQSQRQFYHDCTITGTIDFVFKDAFGMFQNCKLIVRKPLPNQQCMVTAGGRSKAESPSALVFQSCH
  FSGEPQLTQLQPKIACLGRPWKTYG
Full Sequence
Protein Sequence     Length: 369     Download
MGDYNDGKEQ QRRFAVLGIS SILLVAMVAA VGVTLNCGDK GEEENDDHHL HNAQRNNEET    60
LVDDYSSWVN EGQRRLLGLG GIKPNAIVTQ DATSQFATLS DALKTVPPKN VIVGKDMTHV    120
TVIGDGPMYK DEIHRELKLE CKIYNLLCEL FVGERLQASA SSPSQTSSAP VNAANFMAKD    180
VGFENTAGAE KHQAVALRVT ADQAMFYNCQ MDVFQDTPYT QSQRQFYHDC TITGTIDFVF    240
KDAFGMFQNC KLIVRKPLPN QQCMVTAGGR SKAESPSALV FQSCHFSGEP QLTQLQPKIA    300
CLGRPWKTYG PSADTSLRVK WSGVKTITSA AATNYYPGRF FELINSSTER DAWIVDARVP    360
 YSLGSMAA*                                                           420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02217PLN022170.000444443+
PLN02217PLN022172.0e-6956367379+
PLN02990PLN029904.0e-7763361356+
pfam01095Pectinesterase7.0e-9785341314+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACJ85756.10150368105361unknown [Medicago truncatula]
EMBLCAB65290.2048368195549pectin methyl-esterase PER [Medicago truncatula]
EMBLCAB65291.1063366227565pectin methyl-esterase PEF1 [Medicago truncatula]
Swiss-ProtQ42920063366109447PME_MEDSA RecName: Full=Pectinesterase/pectinesterase inhibitor; Includes: RecName: Full=Pectinesterase inhibitor; AltName: Full=Pectin methylesterase inhibitor; Includes: RecName: Full=Pectinesterase; Short=PE; AltName: Full=Pectin methylesterase; AltName: Full=P65; Flags: Precursor
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1xg2_A1e-39823311287B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1gq8_A3e-39823645318A Chain A, Pectin Methylesterase From Carrot
PDB3uw0_A0.0000000000018530632269A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
PDB2ntq_B0.000000000004853065245A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
PDB2ntq_A0.000000000004853065245A Chain A, Pectin Methylesterase From Yersinia Enterocolitica
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2102EC-3.1.1.11pectinesterase
Transmembrane Domains
StartEnd
1335
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
AJ4969462341503440
BI2727272181733510
AW5092801401713100
CX5389541391713090
DT7541573011093680
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_019_00179.1Aquca_017_00134.1Aquca_017_00135.1Aquca_020_00598.1Aquca_012_00160.1
Aquca_035_00109.1Aquca_035_00108.1Aquca_029_00052.1
Arabidopsis lyrata477851910790494979478002859154
320434353497486726483877
Arabidopsis thalianaAT3G05610.1AT5G27870.1AT5G49180.1AT3G06830.1AT4G15980.1
AT4G33230.1AT2G26450.1AT2G47030.1AT2G47040.1AT3G62170.1
Brachypodium distachyonBradi5g23550.1Bradi4g30980.1Bradi1g64860.1Bradi5g12300.1Bradi1g16780.1
Bradi1g60380.1
Brassica rapaBra039421Bra036610Bra009938Bra040293Bra040532
Bra029607Bra020658Bra038049Bra001219Bra000541
Bra001157Bra037013Bra004481Bra000438Bra040474
Bra007665Bra014410Bra003491
Carica papayaevm.model.supercontig_50.162evm.model.supercontig_48.111evm.model.supercontig_82.46evm.model.supercontig_146.24evm.model.supercontig_41.94
Capsella rubellaCarubv10015948mCarubv10003818mCarubv10027546mCarubv10015933mCarubv10007222m
Carubv10024513mCarubv10006885mCarubv10024512mCarubv10025567mCarubv10019418m
Citrus clementinaCiclev10000446mCiclev10000436mCiclev10000435mCiclev10000415mCiclev10007819m
Ciclev10010665m
Citrus sinensisorange1.1g039111morange1.1g035494m
Cucumis sativusCucsa.159100.1Cucsa.181720.1Cucsa.252880.1Cucsa.069220.1Cucsa.374170.1
Cucsa.374150.1Cucsa.374190.1
Fragaria vescamrna22811.1-v1.0-hybridmrna07045.1-v1.0-hybridmrna07046.1-v1.0-hybridmrna07048.1-v1.0-hybridmrna12964.1-v1.0-hybrid
mrna24568.1-v1.0-hybrid
Glycine maxGlyma15g20460.1Glyma09g08910.2Glyma02g01140.1Glyma10g01180.1Glyma0248s00220.1
Glyma07g02790.1Glyma07g02780.1Glyma07g03010.1Glyma07g02750.1Glyma03g39360.1
Glyma01g27260.1Glyma07g37460.1Glyma17g03170.1Glyma19g41970.1Glyma10g29160.1
Glyma20g38160.3Glyma20g38160.2Glyma09g04730.1Glyma09g04720.1Glyma17g04960.1
Glyma13g17550.1Glyma10g27700.1Glyma03g38230.2Glyma02g01130.1Glyma10g27710.1
Glyma19g40840.1
Gossypium raimondiiGorai.009G039000.1Gorai.007G340800.1Gorai.007G302000.1Gorai.006G260800.1Gorai.006G260900.1
Gorai.006G260600.1Gorai.006G260700.1Gorai.004G238800.1Gorai.008G137200.1Gorai.004G146900.1
Gorai.013G218500.1Gorai.007G098400.1Gorai.005G257300.1
Linum usitatissimumLus10006940Lus10015211Lus10031469Lus10018335Lus10037489
Lus10039927Lus10020909Lus10027656Lus10033466Lus10023775
Lus10003968Lus10002976
Malus domesticaMDP0000545023.286.580MDP0000545023.286.580MDP0000267129MDP0000823143MDP0000785852
MDP0000193371MDP0000136674MDP0000200340MDP0000686191MDP0000389664
MDP0000850802MDP0000304455.261.433MDP0000304455.261.433
Manihot esculentacassava4.1_025863mcassava4.1_030825mcassava4.1_027130mcassava4.1_027642mcassava4.1_033112m
cassava4.1_024664mcassava4.1_029816mcassava4.1_029447mcassava4.1_030418mcassava4.1_032868m
Medicago truncatulaMedtr7g112590.1Medtr1g083510.1Medtr1g083500.1Medtr1g083470.1Medtr1g083490.1
Medtr4g005170.1Medtr4g005180.1Medtr1g086190.1Medtr1g086210.1Medtr4g124550.1
Medtr2g044650.1Medtr7g110440.1Medtr7g110510.1Medtr7g110490.1Medtr7g110560.1
Medtr7g110420.1Medtr8g088610.1Medtr5g083620.1Medtr5g083590.1
Mimulus guttatusmgv1a003232mmgv1a003546mmgv1a000814mmgv1a002232mmgv1a003747m
mgv1a003776mmgv1a004121mmgv1a003434mmgv1a003444mmgv1a003726m
mgv1a003697mmgv1a012115mmgv1a027033m
Oryza sativaLOC_Os04g38560.1LOC_Os09g26360.1LOC_Os04g54850.1LOC_Os03g18860.1LOC_Os08g34910.1
LOC_Os03g28090.1LOC_Os07g49100.1
Panicum virgatumPavirv00011682mPavirv00013701mPavirv00057767mPavirv00019846mPavirv00022990m
Pavirv00056855mPavirv00035617mPavirv00014003mPavirv00066510mPavirv00001150m
Phaseolus vulgarisPhvul.007G210400.1Phvul.003G107300.1Phvul.005G015000.1Phvul.005G104100.1Phvul.006G088200.1
Phvul.009G250600.1Phvul.009G222600.1Phvul.007G198100.1Phvul.003G126700.1Phvul.007G198100.2
Phvul.001G217400.1Phvul.001G217300.1Phvul.007G210300.1Phvul.007G210200.1
Populus trichocarpaPotri.018G051200.1Potri.006G134700.1Potri.T030500.1Potri.005G022900.1Potri.013G013400.1
Potri.001G209000.1Potri.003G021600.1Potri.003G021300.1Potri.001G209200.1
Prunus persicappa023802mppa003528mppa026560mppa025631mppa024011m
ppa003441mppa023319mppa003569mppa020185mppa003369m
Ricinus communis29739.m00367629726.m00408330128.m00885829889.m00339630116.m000390
30116.m000389
Setaria italicaSi009724mSi009788mSi015620mSi032329mSi032614m
Si040154m
Sorghum bicolorSb06g018850.1Sb06g030310.1Sb01g037900.1Sb07g022100.1Sb02g025460.1
Sb01g033140.1Sb02g043780.1
Thellungiella halophilaThhalv10003734mThhalv10020314mThhalv10003919mThhalv10020401mThhalv10024582m
Thhalv10024699mThhalv10001934mThhalv10001369mThhalv10005855m
Vitis viniferaGSVIVT01035108001GSVIVT01031165001GSVIVT01017687001GSVIVT01028264001GSVIVT01028265001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)