y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma15g16710.1
FamilyAA2
Protein PropertiesLength: 353 Molecular Weight: 39216.5 Isoelectric Point: 5.8786
ChromosomeChromosome/Scaffold: 15 Start: 13003141 End: 13005340
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2753320
  HNKVKEWIQKDYTLAASLMRLHFHDCSVRGCDGSILLKHDGSERTAQASKTLRGFEVVDDIKAELEKQCPKTVSCADILTAAARDATVELGGPYWAVPYG
  RRDGKVSIAKEADMVPMGHENVTSLIEFFQSRGMAVLDLVVLSGAHTIGRTSCGSIQYRLYNYQGTGKPDPTLDPKYVNFLQRKCRWASEYVDLDATTPK
  TFDNVYYINLEKKMGLLSTDQLLYSDARTSPLVSALAASHSVFEHQFAVSMGKLGIVD
Full Sequence
Protein Sequence     Length: 353     Download
MKNSSLPLLL LLVLYTISAS SRPYENYDDK SSLSSTISET VFSLQVPALD ETTFDNLLSF    60
GYYRKTCPQF ESILHNKVKE WIQKDYTLAA SLMRLHFHDC SVRGCDGSIL LKHDGSERTA    120
QASKTLRGFE VVDDIKAELE KQCPKTVSCA DILTAAARDA TVELGGPYWA VPYGRRDGKV    180
SIAKEADMVP MGHENVTSLI EFFQSRGMAV LDLVVLSGAH TIGRTSCGSI QYRLYNYQGT    240
GKPDPTLDPK YVNFLQRKCR WASEYVDLDA TTPKTFDNVY YINLEKKMGL LSTDQLLYSD    300
ARTSPLVSAL AASHSVFEHQ FAVSMGKLGI VDVLTGLEEG EIRTNCNFVN DY*           360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00141peroxidase0.00328231332+
cd00314plant_peroxidase_like4.0e-2382329267+
pfam00141peroxidase5.0e-6478222146+
PLN03030PLN030307.0e-8361350298+
cd00693secretory_peroxidase2.0e-15858349298+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU16698.1012451246unknown [Glycine max]
EMBLCAN60117.10583505308hypothetical protein [Vitis vinifera]
EMBLCBI27386.101835020341unnamed protein product [Vitis vinifera]
RefSeqXP_002265231.101835020355PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002304610.10623501290predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1fhf_C0623506303A Chain A, The Structure Of Soybean Peroxidase
PDB1fhf_B0623506303A Chain A, The Structure Of Soybean Peroxidase
PDB1fhf_A0623506303A Chain A, The Structure Of Soybean Peroxidase
PDB1qo4_A0623507304A Chain A, The Structure Of Soybean Peroxidase
PDB1pa2_A0623507304A Chain A, Arabidopsis Thaliana Peroxidase A2
Metabolic Pathways
Pathway NameReactionECProtein Name
betanidin degradationRXN-8635EC-1.11.1.7peroxidase
Signal Peptide
Cleavage Site
21
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO041224261933530
CK6060042201343530
GO037772255993530
EV28240026912680
DW115035272313010
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00303.1
Arabidopsis lyrata473329
Arabidopsis thalianaAT1G30870.1
Brachypodium distachyonBradi1g26870.1
Brassica rapaBra014895Bra039872Bra023149
Capsella rubellaCarubv10010885m
Citrus clementinaCiclev10006591mCiclev10017746m
Citrus sinensisorange1.1g035963morange1.1g044134m
Cucumis sativusCucsa.118700.1Cucsa.134680.1
Eucalyptus grandisEucgr.F03670.1
Fragaria vescamrna19723.1-v1.0-hybridmrna19930.1-v1.0-hybrid
Glycine maxGlyma08g17300.1Glyma15g39210.2Glyma09g05340.1
Gossypium raimondiiGorai.011G069800.1
Linum usitatissimumLus10038393Lus10001228
Malus domesticaMDP0000171732MDP0000313080MDP0000190959MDP0000216403MDP0000906162
Manihot esculentacassava4.1_030325mcassava4.1_027488m
Medicago truncatulaMedtr4g133800.1
Mimulus guttatusmgv1a009857mmgv1a023785m
Oryza sativaLOC_Os07g31610.1
Panicum virgatumPavirv00017305mPavirv00018140m
Physcomitrella patensPp1s354_23V6.1
Phaseolus vulgarisPhvul.005G046000.1Phvul.009G244500.1
Picea abiesMA_44564g0010MA_10201061g0010MA_125874g0020
Populus trichocarpaPotri.010G175100.1Potri.003G156100.1
Prunus persicappa023679mppa017551m
Setaria italicaSi030295m
Sorghum bicolorSb02g033790.1
Thellungiella halophilaThhalv10008077m
Vitis viniferaGSVIVT01010080001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny