y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma15g35931.1
FamilyGH35
Protein PropertiesLength: 255 Molecular Weight: 29140.4 Isoelectric Point: 9.5031
ChromosomeChromosome/Scaffold: 15 Start: 40802591 End: 40808477
Descriptionbeta galactosidase 9
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35101600
  IENEYGKGGKEYRKWAAKKALSLGVGVPWVMCRQQDAPYDIIDTCNAYYCDGFKPNSHNKPTMWTENWDGWYTQWGERLPHRPVEDLAFAVACFFQRGGS
  FQNYYMYFGRTNFGRTAGGPLQITSYDYVASIDEYGQLREPKWGHLKDLHA
Full Sequence
Protein Sequence     Length: 255     Download
MAGMHFFPMI ENEYGKGGKE YRKWAAKKAL SLGVGVPWVM CRQQDAPYDI IDTCNAYYCD    60
GFKPNSHNKP TMWTENWDGW YTQWGERLPH RPVEDLAFAV ACFFQRGGSF QNYYMYFGRT    120
NFGRTAGGPL QITSYDYVAS IDEYGQLREP KWGHLKDLHA ALKLCEPALV ATDSPTYIKL    180
GPNQEIGTLS MLRSRFQSLP GAFNTCLVPF DKKQKGRFSS QRNLLRLLQA KEMKLPNLHN    240
YGMRLFAVST RKIS*                                                     300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam01301Glyco_hydro_352.0e-6010162175+
PLN03059PLN030597.0e-8310185183+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAQ62586.1010185207382putative beta-galactosidase [Glycine max]
DDBJBAD91079.1010185196371beta-D-galactosidase [Pyrus pyrifolia]
DDBJBAE72075.1010191196377pear beta-galactosidase3 [Pyrus communis]
RefSeqXP_002328900.1010225196419predicted protein [Populus trichocarpa]
RefSeqXP_002518051.1010185200375beta-galactosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4e8d_B0.00000000910145153313A Chain A, Hevamine Mutant D125aE127A IN COMPLEX WITH TETRA-Nag
PDB4e8d_A0.00000000910145153313A Chain A, Hevamine Mutant D125aE127A IN COMPLEX WITH TETRA-Nag
PDB4e8c_B0.00000000910145153313A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose
PDB4e8c_A0.00000000910145153313A Chain A, Crystal Structure Of Streptococcal Beta-Galactosidase In Complex With Galactose
PDB3d3a_A0.0000000310158159325A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Metabolic Pathways
Pathway NameReactionECProtein Name
lactose degradation IIIBETAGALACTOSID-RXNEC-3.2.1.23β-galactosidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO798191175111850
GO008548175101840
EB154062182101910
EY766919175101840
ES819753209102120
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00261.4Aquca_034_00110.2
Brassica rapaBra013956.94.331Bra015236Bra003370Bra018721Bra013956.94.331
Carica papayaevm.model.supercontig_18.156
Citrus clementinaCiclev10007838mCiclev10004420mCiclev10000553m
Citrus sinensisorange1.1g007315morange1.1g006468morange1.1g004668morange1.1g005404m
Cucumis sativusCucsa.397380.5Cucsa.342700.4Cucsa.256570.2Cucsa.229010.2Cucsa.397380.6
Eucalyptus grandisEucgr.A01556.1.101.314Eucgr.A01556.1.101.314Eucgr.A01181.1
Fragaria vescamrna15210.1-v1.0-hybrid
Glycine maxGlyma09g21980.2.142.289Glyma09g21980.2.142.289Glyma14g07700.3
Gossypium raimondiiGorai.003G059500.4Gorai.011G065300.5Gorai.003G059500.3Gorai.003G059500.2Gorai.013G223000.1.124.295
Gorai.013G223000.1.124.295
Linum usitatissimumLus10023977.605.818
Manihot esculentacassava4.1_029736m
Medicago truncatulaMedtr1g018200.2AC235665_1070.1.117.327AC235665_1070.1.117.327
Mimulus guttatusmgv1a002308m
Oryza sativaLOC_Os03g15020.3
Panicum virgatumPavirv00064750m
Picea abiesMA_217488g0010MA_14774g0010
Populus trichocarpaPotri.007G018100.3Potri.006G144500.6Potri.001G200400.4Potri.001G200400.5
Prunus persicappa002177m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny