y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma15g37670.1
FamilyGH2
Protein PropertiesLength: 800 Molecular Weight: 89601.4 Isoelectric Point: 6.2494
ChromosomeChromosome/Scaffold: 15 Start: 43562082 End: 43570526
Descriptionglycoside hydrolase family 2 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH21786640
  EPKWATAMMDRVIGMVERDKNHTCIISWSLGNESGFGTNHFALAGWIRGRDSSRVLHYEGGGSRTPCTDIVCPMYMRVWDMVKISNDPTETRPLILCEYS
  HAMGNSNGNLHIYWEAIDNTFGLQGGFIWDWVDQALVKVYEDGTKHWAYGGEFGDVPNDLNFCLNGLTFPDRTPHPVLHEVKYLYQPTKVALKEGKLEIK
  NTHFFQTTEGLEFSWSISADGYNLGSGILGLTHIKPQSSYAVDWQSGPWYSLWASADEEELFLTIMAKLLNSTRWVADGDIVSSAQVQLTARRNIIPHWW
  HSLVAETLGDTIIVKQQDVWDLTLNTKTGLVESWKVRGVHVMKKGILPCFWRAPIDNDKGGNSASYLSRWKAAGMDCLHFITESCSVQNITENSVTILVV
  FVGVTKGEDGSISNQDKSKVLYTTEMTYTIYASGDVIIECNMKPNPDLPPLPRVGIELNVEKSLDQATWYGRGPFECYPDRKAAAQI
Full Sequence
Protein Sequence     Length: 800     Download
VFITDYFFKA NLAEDFSYAE IMVEVKIDRL QETSKDNVLT NYTIEATLFD SGSWYTSDGN    60
PDLLSSNLAD IKLQPSSAPT QPLGFHGYVL TGELQSPKLW SAEKPYLYTL VVVLKDRSGR    120
VVDCESCPVG FRKVSKAHKQ LLVNGHAVVI RGVNRHEHHP QVGKANIESC MIKHPTMEPK    180
WATAMMDRVI GMVERDKNHT CIISWSLGNE SGFGTNHFAL AGWIRGRDSS RVLHYEGGGS    240
RTPCTDIVCP MYMRVWDMVK ISNDPTETRP LILCEYSHAM GNSNGNLHIY WEAIDNTFGL    300
QGGFIWDWVD QALVKVYEDG TKHWAYGGEF GDVPNDLNFC LNGLTFPDRT PHPVLHEVKY    360
LYQPTKVALK EGKLEIKNTH FFQTTEGLEF SWSISADGYN LGSGILGLTH IKPQSSYAVD    420
WQSGPWYSLW ASADEEELFL TIMAKLLNST RWVADGDIVS SAQVQLTARR NIIPHWWHSL    480
VAETLGDTII VKQQDVWDLT LNTKTGLVES WKVRGVHVMK KGILPCFWRA PIDNDKGGNS    540
ASYLSRWKAA GMDCLHFITE SCSVQNITEN SVTILVVFVG VTKGEDGSIS NQDKSKVLYT    600
TEMTYTIYAS GDVIIECNMK PNPDLPPLPR VGIELNVEKS LDQATWYGRG PFECYPDRKA    660
AAQIAVYEHN VGELHVPYIV PGESSGRADV RWATFRNKNG FGIYASKYGS SPPMQMSASY    720
YSTLEFDRAT HNEELIEGDS IEIHLDHKHM GLGGDDSWSP CVHKQYLIPP VPYSFSVRLC    780
PVTPATSGHN IYKSQFKNS*                                                840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02929Bgal_small_N9.0e-77499780284+
COG3250LacZ7.0e-7794665628+
smart01038Bgal_small_N5.0e-93499779282+
PRK10340ebgA6.0e-1423782841+
PRK09525lacZ01781870+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0004565beta-galactosidase activity
GO:0005975carbohydrate metabolic process
GO:0009341beta-galactosidase complex
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002266400.1017982611114PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002266434.1017982611115PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
RefSeqXP_002299206.1017982611110predicted protein [Populus trichocarpa]
RefSeqXP_002303929.1017982611113predicted protein [Populus trichocarpa]
RefSeqXP_002513059.1017982611110beta-galactosidase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1jz2_D0947802951021A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB1jz2_C0947802951021A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB1jz2_B0947802951021A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB1jz2_A0947802951021A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB1jz1_P0947802951021A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Metabolic Pathways
Pathway NameReactionECProtein Name
lactose degradation IIIBETAGALACTOSID-RXNEC-3.2.1.23β-galactosidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR8589452745247970
EX5243512635377990
DY3056703432085460
ES7944863551625050
FG9314852275748000
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00605.1Aquca_014_00605.2
Arabidopsis lyrata485844
Arabidopsis thalianaAT3G54440.1AT3G54440.2AT3G54440.3
Brachypodium distachyonBradi2g61010.1
Brassica rapaBra014816
Carica papayaevm.model.supercontig_540.3
Capsella rubellaCarubv10019396m
Chlamydomonas reinhardtiiCre08.g379450.t1.3
Citrus clementinaCiclev10030068mCiclev10027821m
Citrus sinensisorange1.1g004315morange1.1g004363morange1.1g006933morange1.1g023943morange1.1g023667m
orange1.1g022918morange1.1g007038m
Cucumis sativusCucsa.307940.11Cucsa.307940.1Cucsa.307940.12
Eucalyptus grandisEucgr.J01181.1
Fragaria vescamrna14286.1-v1.0-hybrid
Glycine maxGlyma13g26700.1
Gossypium raimondiiGorai.010G216500.1
Linum usitatissimumLus10024155Lus10039520Lus10039519
Manihot esculentacassava4.1_002723m
Medicago truncatulaMedtr8g039160.1
Mimulus guttatusmgv1a000801m
Oryza sativaLOC_Os01g72340.1
Panicum virgatumPavirv00010284mPavirv00069653m
Physcomitrella patensPp1s130_43V6.1
Phaseolus vulgarisPhvul.011G206800.1
Picea abiesMA_10429668g0010
Populus trichocarpaPotri.003G196500.1Potri.003G196500.2Potri.001G027400.1
Prunus persicappa000508mppa000532m
Ricinus communis30131.m007196
Setaria italicaSi000118mSi000119m
Selaginella moellendorffii181800
Sorghum bicolorSb03g046050.2Sb03g046050.1
Thellungiella halophilaThhalv10010080m
Vitis viniferaGSVIVT01013489001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny