y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma15g42330.2
FamilyGT48
Protein PropertiesLength: 1949 Molecular Weight: 224919 Isoelectric Point: 9.4697
ChromosomeChromosome/Scaffold: 15 Start: 49730875 End: 49750319
Descriptionglucan synthase-like 3
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT48104917990
  VPSNLDARRRISFFSNSLFMDMPPAPKVRNMLSFSVLTPYFDEAVLFSLNNLEKQNEDGVSILFYLQKIFPDEWKNFVQRFDNKSEEKLRVENEEDLRLW
  ASYRGQTLTKTVRGMMYIRQALELQAFLDMAKDEELMKGYKAAELESMESTTGERSLWTQCQSLADMKFTYVVSCQQYSIHKRSGDSRAKEILKLMIKYP
  SLRVAYIDEVEEHIKDSSRKTDKVYYSALVKAALPSKSNDSSETVQSLDQVIYKIKLPGPAILGEGKPENQNHAIIFTRGEGLQTIDMNQDNYMEEAFKM
  RNLLQEFLKQHDGPRMPTILGLREHIFTGSVSSLAWFMSNQEHSFVTIGQRLLAYPLKVRFHYGHPDVFDRLFHLTRGGVSKASKVINLSEDIFAGYNST
  LREGNVTHHEYIQVGKGRDVGLNQISMFEAKIAAGNGEQTMSRDIYRLGHRFDFFRMLSCYYTTIGFYFSTLITVLTVYVFLYGRLYLALSGVEESLNKQ
  RAIRDNKALQVALASQSVVQIGFLLALPMLMEIGLERGFREALSEFVLMQLQLAPVFFTFSLGTKTHYYGRTLLHGGAEYKGTGRGFVVFHAKFADNYRL
  YSRSHFVKGIELMILLVVYHIFGHGYRGVVAYILITVTMWFMVGTWLFAPFLFNPSGFEWQKIVDDYTDWQKWISNRGGIGVSPQKSWESWWEKEHEHLR
  HSGKRGIATEIILALRFFIYQYGLVYHLSVTDEKTQSVLVYGLSWLIIFVI
Full Sequence
Protein Sequence     Length: 1949     Download
MSYRRGSDQP PQRRILRTQT AGNLGADPIL DSEVVPSSLV EIAPILRVAN EVEASNKRVG    60
YLCRFYAFEL AHRLDPQSSG RGVRQFKTAL LQRLEKENVT TQEGRKKSDA REMQAFYRQY    120
YEKYIQALDK AADKDRAQLT KAYQTAAVLF EVLKAVNRIE DIPVSDEIME AHIKVEEQKQ    180
LYAPYNILPL DPNSGKEAIM RYHEIQASVS ALRNTRGLPW PKEHGNKVNE DILDWLQLMF    240
GFQKDNVENQ REHLILLLAN VHIRQVPKPD QQPKLDDRAL NEVMKKLFRN YKKWCKYLGR    300
KSSLWLPTIQ QEMQQRKLLY MGLYLLIWGE AANLRFMPEC LCYIYHHMAF ELYGMLAGNV    360
SPLTGEPVKP AYGGDNEAFL MKVVKPIYDV IAKEAKRSNM GKAKHSHWRN YDDLNEYFWS    420
VDCFRLGWPM RVDSDFFSVP FPQQERQVNK DEENRGPASD RWSGKTNFVE IRTFWHIFRS    480
FDRMWSFYIL CLQAMIIIAW NGSGELSSIF RGDVFKQVLS IFITAAILKL AQAILDIFLS    540
WKARKVMSLH VQLRYIFKAI LAAAWVIILP VTYAYSWKNP SGFAQTIKNW FGNGTGSPSL    600
FILAVFIYLS PNILSALLFV FPFIRQFLER SNNGVVKLMM WWSQPRLFVG RGMQEGPISL    660
LKYTSFWVML ILSKLAFSYY LEIKPLVAPT KAIMNAHVSV YRWHEFFPHA RNNIGVVIAI    720
WSPIILVYFM DTQIWYAIFS TIVGGIYGAF RRLGEIRTLE LLRSRFESIP GAFNACLIPT    780
EQTEKKKKRG LKATFSRRFD QVASNKEKES ARFAQLWNKI ITSLREEDLI DNREMDLMLV    840
PYSADRSLNL IQWPPFLLAS KIPIAVSMAQ DSLGKGQELE KRLLRDKYMK SAVEECYASF    900
KSIINFLVLG ERETMVIQNI FQRVDEHIEN KAVLNELNLS AVPSLYERFV KLIERLLENK    960
EEDKDSIVIF LLDMLEIVTR DIMDGDIEGL LDSSHGGSYG KDERFTPLEK QYKFFGKLQF    1020
PVKTDIDAWA EKIKRLQLLL TVKESAMDVP SNLDARRRIS FFSNSLFMDM PPAPKVRNML    1080
SFSVLTPYFD EAVLFSLNNL EKQNEDGVSI LFYLQKIFPD EWKNFVQRFD NKSEEKLRVE    1140
NEEDLRLWAS YRGQTLTKTV RGMMYIRQAL ELQAFLDMAK DEELMKGYKA AELESMESTT    1200
GERSLWTQCQ SLADMKFTYV VSCQQYSIHK RSGDSRAKEI LKLMIKYPSL RVAYIDEVEE    1260
HIKDSSRKTD KVYYSALVKA ALPSKSNDSS ETVQSLDQVI YKIKLPGPAI LGEGKPENQN    1320
HAIIFTRGEG LQTIDMNQDN YMEEAFKMRN LLQEFLKQHD GPRMPTILGL REHIFTGSVS    1380
SLAWFMSNQE HSFVTIGQRL LAYPLKVRFH YGHPDVFDRL FHLTRGGVSK ASKVINLSED    1440
IFAGYNSTLR EGNVTHHEYI QVGKGRDVGL NQISMFEAKI AAGNGEQTMS RDIYRLGHRF    1500
DFFRMLSCYY TTIGFYFSTL ITVLTVYVFL YGRLYLALSG VEESLNKQRA IRDNKALQVA    1560
LASQSVVQIG FLLALPMLME IGLERGFREA LSEFVLMQLQ LAPVFFTFSL GTKTHYYGRT    1620
LLHGGAEYKG TGRGFVVFHA KFADNYRLYS RSHFVKGIEL MILLVVYHIF GHGYRGVVAY    1680
ILITVTMWFM VGTWLFAPFL FNPSGFEWQK IVDDYTDWQK WISNRGGIGV SPQKSWESWW    1740
EKEHEHLRHS GKRGIATEII LALRFFIYQY GLVYHLSVTD EKTQSVLVYG LSWLIIFVIL    1800
GLMKGVSVGR RRLSADYQLL FRLIEGSIFL TFLAIFIILI LLANMTIKDI IVCILAVMPT    1860
GWGMLLIAQA CKPLIEKTGF WGSVRALARG YEVIMGLLLF TPVAFLAWFP FVSEFQTRML    1920
FNQAFSRGLQ ISRILGGQRS ERSSNHKE*                                      1980
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR02854spore_II_GA0.009527684163+
pfam04652DUF6059.0e-1042186154+
pfam14288FKS1_dom11.0e-56315431118+
pfam02364Glucan_synthase010491802838+
Gene Ontology
GO TermDescription
GO:00001481,3-beta-D-glucan synthase complex
GO:00038431,3-beta-D-glucan synthase activity
GO:0006075(1->3)-beta-D-glucan biosynthetic process
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAK37413.101194811950AF237733_1 callose synthase 1 catalytic subunit [Arabidopsis thaliana]
RefSeqNP_850178.101194811959ATGSL03 (GLUCAN SYNTHASE-LIKE 3); 1,3-beta-glucan synthase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
Swiss-ProtQ9SL0301194811951CALS2_ARATH RecName: Full=Callose synthase 2; AltName: Full=1,3-beta-glucan synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 3
RefSeqXP_002271648.101194811946PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002528124.1051948111955transferase, transferring glycosyl groups, putative [Ricinus communis]
Metabolic Pathways
Pathway NameReactionECProtein Name
callose biosynthesis13-BETA-GLUCAN-SYNTHASE-RXNEC-2.4.1.341,3-β-glucan synthase
Transmembrane Domains
StartEnd
485504
519541
553575
601623
659681
707729
734751
15091531
15571579
15941611
16761698
17561778
17851807
18221844
18511870
18901912
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO780496341137217120
HO780496135123713710
HO780496204169919020
HO7836344484158610
HO783634528559040.061
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_056_00094.1Aquca_014_00906.1Aquca_019_00181.4Aquca_019_00181.3Aquca_019_00181.1
Aquca_016_00166.1Aquca_019_00181.2Aquca_084_00016.4Aquca_084_00016.3Aquca_084_00016.2
Aquca_084_00016.1Aquca_022_00132.2Aquca_022_00132.1Aquca_014_00908.4Aquca_014_00908.3
Aquca_014_00908.2Aquca_014_00908.1Aquca_014_00908.5Aquca_008_00266.1Aquca_039_00091.4
Aquca_039_00091.2Aquca_039_00091.1Aquca_039_00091.3Aquca_056_00094.2
Arabidopsis lyrata340908482666470669899601907409
878725482124490214490142897726
325786
Arabidopsis thalianaAT3G07160.1AT2G36850.1AT1G06490.1AT4G03550.1AT2G13680.1
AT1G05570.2AT1G05570.1AT4G04970.1AT3G59100.1AT2G31960.2
AT2G31960.1AT5G13000.1AT5G13000.2AT3G14570.2AT3G14570.1
AT5G36870.1
Brachypodium distachyonBradi1g51757.1Bradi1g77247.2Bradi1g77247.1Bradi1g47427.1Bradi2g50140.1
Bradi3g60790.2Bradi3g60790.1Bradi1g29622.1Bradi1g76617.1Bradi2g46250.1
Bradi2g40460.1Bradi3g09317.1Bradi2g40430.1
Brassica rapaBra005239Bra029628Bra001239Bra040364Bra015504
Bra034218Bra032416Bra037213Bra029541Bra015436
Bra003364Bra023386Bra008864Bra005624Bra027328
Carica papayaevm.model.supercontig_42.151evm.model.supercontig_189.7evm.model.supercontig_25.167evm.model.supercontig_858.3evm.model.supercontig_2050.2
evm.model.supercontig_3407.1evm.model.supercontig_50.100evm.model.supercontig_4.57
Capsella rubellaCarubv10022498mCarubv10022499m
Citrus clementinaCiclev10014066mCiclev10018457mCiclev10018456mCiclev10000018mCiclev10018223m
Ciclev10030477mCiclev10030476mCiclev10014015mCiclev10030481mCiclev10030478m
Ciclev10030495mCiclev10024186mCiclev10030599mCiclev10030560mCiclev10030796m
Citrus sinensisorange1.1g000946morange1.1g000813morange1.1g000382morange1.1g000253morange1.1g000219m
orange1.1g000179morange1.1g000260morange1.1g000273morange1.1g000180morange1.1g000261m
orange1.1g045737morange1.1g000259morange1.1g000258morange1.1g001004morange1.1g000585m
orange1.1g000171morange1.1g000349morange1.1g000165morange1.1g001473morange1.1g000389m
orange1.1g000385morange1.1g040336morange1.1g000763m
Cucumis sativusCucsa.157510.4Cucsa.157510.3Cucsa.157510.2Cucsa.157510.1Cucsa.142920.1
Cucsa.249900.1Cucsa.119100.1Cucsa.126670.1Cucsa.239610.1Cucsa.049980.10
Cucsa.142930.1Cucsa.049980.1Cucsa.058220.1Cucsa.058230.1
Eucalyptus grandisEucgr.B00160.1Eucgr.B03640.2Eucgr.B03640.1Eucgr.I00208.1Eucgr.K01028.4
Eucgr.K01028.3Eucgr.K01028.2Eucgr.K01028.1Eucgr.D00621.1Eucgr.A01821.1
Eucgr.K01027.1Eucgr.D00622.1Eucgr.J00836.1Eucgr.J00827.1Eucgr.F01403.1
Eucgr.A01827.1Eucgr.A02008.1Eucgr.A01817.1Eucgr.A01994.2Eucgr.A01994.1
Eucgr.A02010.1Eucgr.J00836.2Eucgr.A01997.1
Fragaria vescamrna09912.1-v1.0-hybridmrna17912.1-v1.0-hybridmrna17710.1-v1.0-hybridmrna28731.1-v1.0-hybridmrna02397.1-v1.0-hybrid
mrna24411.1-v1.0-hybridmrna26782.1-v1.0-hybridmrna28728.1-v1.0-hybrid.526.840mrna28728.1-v1.0-hybrid.526.840
Glycine maxGlyma06g18216.1Glyma04g36725.1Glyma20g38860.1Glyma10g44150.1Glyma05g32500.4
Glyma05g32500.3Glyma05g32500.2Glyma08g16660.1Glyma04g39120.2Glyma04g39120.1
Glyma13g37290.2Glyma08g42150.3Glyma08g42150.2Glyma08g42150.1Glyma18g12870.3
Glyma18g12870.2Glyma18g12870.1Glyma15g08020.3Glyma15g08020.2Glyma15g08020.1
Glyma15g42330.4Glyma15g42330.3Glyma18g53823.1Glyma08g47670.1Glyma08g47670.2
Glyma18g13105.9Glyma18g13105.8Glyma18g13105.7Glyma18g13105.6Glyma18g13105.10
Glyma18g13105.3Glyma18g13105.2Glyma18g13105.1Glyma18g13105.5Glyma18g13105.4
Glyma15g39420.2Glyma13g33560.1Glyma05g32500.6Glyma05g32500.5Glyma08g42110.1
Glyma06g44770.3Glyma06g44770.2Glyma13g31310.1Glyma06g44770.4Glyma10g44150.2
Glyma08g16715.1Glyma06g15860.1.320.682Glyma06g15860.1.320.682Glyma08g16730.2
Gossypium raimondiiGorai.004G018200.3Gorai.004G018200.1Gorai.004G018200.2Gorai.003G109000.6Gorai.003G109000.1
Gorai.003G109000.2Gorai.003G109000.3Gorai.003G109000.4Gorai.011G120300.1Gorai.005G201500.2
Gorai.005G201500.1Gorai.011G119900.1Gorai.013G075600.1Gorai.004G092500.3Gorai.004G092500.2
Gorai.004G092500.1Gorai.011G096900.3Gorai.011G096900.1Gorai.004G092600.3Gorai.004G092600.1
Gorai.009G169700.3Gorai.009G169700.2Gorai.009G169700.1Gorai.012G187400.3Gorai.012G187400.2
Gorai.012G187400.1Gorai.004G092600.2Gorai.004G092600.4Gorai.012G040000.2Gorai.012G040000.1
Gorai.005G042700.1Gorai.005G043100.1Gorai.012G128700.1Gorai.007G334800.1Gorai.007G334800.2
Gorai.003G109000.5
Linum usitatissimumLus10014796Lus10032463Lus10039828Lus10000266Lus10031648
Lus10033689Lus10001424Lus10001056Lus10003920Lus10039199
Lus10037469Lus10013744Lus10033483Lus10007327Lus10030030
Lus10042478Lus10020893Lus10020750Lus10040891.301.669Lus10040891.301.669
Lus10002096Lus10002097
Malus domesticaMDP0000174437MDP0000286691MDP0000245319MDP0000275961MDP0000915307
MDP0000229527MDP0000230907MDP0000203763MDP0000321472MDP0000220467
MDP0000308574MDP0000198973MDP0000230621MDP0000212172.415.839MDP0000212172.415.839
MDP0000372473MDP0000310065MDP0000213931MDP0000218486.624.863MDP0000218486.624.863
MDP0000218486.624.863
Manihot esculentacassava4.1_001919mcassava4.1_031653mcassava4.1_029201mcassava4.1_000111mcassava4.1_000342m
cassava4.1_000112mcassava4.1_000082mcassava4.1_026004mcassava4.1_002527mcassava4.1_003374m
cassava4.1_003342mcassava4.1_006866mcassava4.1_028751mcassava4.1_033421m
Medicago truncatulaMedtr4g078220.1Medtr3g047390.1Medtr7g005950.1Medtr1g116370.1AC235753_1023.1
Medtr1g116470.1.521.981Medtr1g116470.1.521.981Medtr1g116470.1.228.504Medtr1g116470.1.228.504
Mimulus guttatusmgv1a000080mmgv1a000075mmgv1a000084mmgv1a000082mmgv1a000070m
mgv1a000067mmgv1a000108mmgv1a024191mmgv1a000066mmgv1a000106m
mgv1a000068m
Oryza sativaLOC_Os06g08380.1LOC_Os02g58560.1LOC_Os01g55040.1LOC_Os06g51270.1LOC_Os03g03610.3
LOC_Os03g03610.2LOC_Os03g03610.1LOC_Os02g58560.3LOC_Os02g14900.1LOC_Os01g34930.1
LOC_Os01g48200.1LOC_Os01g34890.1LOC_Os01g34880.1
Panicum virgatumPavirv00009928mPavirv00009617mPavirv00009495mPavirv00057448mPavirv00022973m
Pavirv00045342mPavirv00015084mPavirv00020404mPavirv00041942mPavirv00010502m
Pavirv00026821mPavirv00007196mPavirv00061397mPavirv00045035mPavirv00040188m
Pavirv00056028mPavirv00049749mPavirv00048524mPavirv00058599m
Physcomitrella patensPp1s88_136V6.1Pp1s160_88V6.1Pp1s40_186V6.2Pp1s67_234V6.1Pp1s67_70V6.1
Pp1s145_49V6.1Pp1s18_300V6.2Pp1s199_13V6.1Pp1s13_132V6.1Pp1s13_432V6.1
Pp1s379_24V6.1Pp1s66_72V6.1
Phaseolus vulgarisPhvul.007G004900.2Phvul.007G004900.1Phvul.007G004900.3Phvul.002G272000.1Phvul.009G150300.2
Phvul.009G150300.1Phvul.011G113800.1Phvul.006G185600.2Phvul.006G185600.1Phvul.006G032100.1
Phvul.006G031900.1Phvul.005G103600.1Phvul.008G002300.1Phvul.005G040900.2Phvul.007G005100.1
Phvul.005G040900.1Phvul.005G062500.1Phvul.009G169400.1
Picea abiesMA_10428413g0040MA_826577g0010MA_960362g0010MA_10426974g0030MA_735748g0010
MA_6205g0020MA_10426974g0020MA_10430560g0010MA_10431062g0010MA_229544g0010
MA_10434444g0010MA_10431631g0010
Populus trichocarpaPotri.015G089300.1Potri.001G011900.1Potri.005G058300.2Potri.005G058300.1Potri.013G131300.1
Potri.001G230000.9Potri.001G230000.8Potri.001G230000.7Potri.001G230000.6Potri.001G230000.5
Potri.001G230000.4Potri.001G230000.3Potri.001G230000.2Potri.001G230000.17Potri.001G230000.16
Potri.011G052400.6Potri.011G052400.5Potri.011G052400.4Potri.011G052400.3Potri.011G052400.2
Potri.011G052400.1Potri.002G058700.3Potri.002G058700.2Potri.002G058700.1Potri.001G012200.3
Potri.001G012200.1Potri.001G012200.2Potri.005G203500.2Potri.005G203500.1Potri.003G214200.2
Potri.003G214200.1Potri.011G095100.2Potri.011G095100.1Potri.001G230000.10Potri.001G230000.18
Potri.001G012200.5Potri.001G012200.4Potri.005G203500.3Potri.001G230000.11Potri.001G230000.12
Potri.001G230000.13
Prunus persicappa000071mppa000167mppa000077mppa000074mppa001863m
ppa000121mppa000112mppa002267mppa000073mppa003008m
ppa000306m
Ricinus communis30147.m01381228035.m00035829691.m00028229983.m00319129734.m000419
28035.m00035929759.m00028130226.m00202329983.m00319229851.m002416
Setaria italicaSi033860mSi034369mSi034352mSi008368mSi016068m
Si016067mSi000021mSi000023mSi000022mSi000017m
Si033956mSi033893mSi033872mSi016150mSi000059m
Selaginella moellendorffii133452439692163802267830177798
449402
Sorghum bicolorSb10g005550.1Sb04g038510.1Sb10g030970.1Sb01g048630.1Sb03g023490.1
Sb03g030800.1Sb03g034880.1Sb04g008830.1
Thellungiella halophilaThhalv10019878mThhalv10016126mThhalv10006529mThhalv10022518mThhalv10028360m
Thhalv10028359mThhalv10006533mThhalv10006528mThhalv10016125mThhalv10012412m
Thhalv10005734mThhalv10019876mThhalv10029222m
Vitis viniferaGSVIVT01025370001GSVIVT01007560001GSVIVT01026489001GSVIVT01001361001GSVIVT01020854001
GSVIVT01025362001GSVIVT01000622001GSVIVT01005204001GSVIVT01020548001.494.863GSVIVT01020548001.494.863
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)