y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma16g07421.1
FamilyCE8
Protein PropertiesLength: 245 Molecular Weight: 27236.2 Isoelectric Point: 5.625
ChromosomeChromosome/Scaffold: 16 Start: 6662993 End: 6668694
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE81752403e-24
  DSITSYLGRPWKQYSRTLFLKTNLDGLIDPNGWGEWIKDFALSTLYYGEYMNTRSGASTQNRVTWS
CE8851641.7e-35
  STISSVTFDVSGDGFWARDMTFENRAGPRGHQAVALRVSSDLSVFYKCSFKGYQDTLLQFYRDCHIYGTIDFIFGDASVV
Full Sequence
Protein Sequence     Length: 245     Download
MIYGHLNNIT ISKPLQETLS ESEGGLLASW SSGTSNADFT VAQDGSGTHK TITEAIDALD    60
AMDNNRPSRP IIYVKSGVYN EKGYSTISSV TFDVSGDGFW ARDMTFENRA GPRGHQAVAL    120
RVSSDLSVFY KCSFKGYQDT LLQFYRDCHI YGTIDFIFGD ASVVKPAYDF DSSKDSITSY    180
LGRPWKQYSR TLFLKTNLDG LIDPNGWGEW IKDFALSTLY YGEYMNTRSG ASTQNRVTWS    240
GFHV*                                                                300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02201PLN022015.0e-6937244283+
PLN02301PLN023011.0e-7426244294+
PLN02713PLN027136.0e-7640244282+
pfam01095Pectinesterase2.0e-9738244282+
PLN02916PLN029167.0e-1155244316+
Gene Ontology
GO TermDescription
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAB82677.1024244181463pectinesterase-like protein [Arabidopsis thaliana]
EMBLCAN75818.1013244145452hypothetical protein [Vitis vinifera]
RefSeqNP_191632.2024244191486pectinesterase family protein [Arabidopsis thaliana]
RefSeqXP_002274478.1013244145452PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002511680.1024244144439Pectinesterase-2 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A0322442286A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A0372443282B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB1qjv_B0.0000001341843210A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB1qjv_A0.0000001341843210A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
PDB2ntq_B0.0000001341843210A Chain A, Pectin Methylesterase Pema From Erwinia Chrysanthemi
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2102EC-3.1.1.11pectinesterase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EH038845283372440
FS341152193932440
GH171221234542320
EE076581280372410
EC939603251692440