y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma16g08350.3
FamilyGT77
Protein PropertiesLength: 589 Molecular Weight: 66547.6 Isoelectric Point: 6.7202
ChromosomeChromosome/Scaffold: 16 Start: 7674426 End: 7682363
Descriptionxyloglucanase 113
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771513750
  VSNFLVGAMDTKLLEALYWKGIPVFDMGSHMSTVDVGWGSPTFHKMGREKVILIDSILPFGFELLMCDTDMVWLKNPLPYLARYPEADVLTSSDQVIPTV
  VDDSLENWPEVSGAYNIGIFHWRPTESAKKLAKQWKEMLLADDQIWDQNGFNDIVHRQLGPSVDDESGLVFVFDGKLKLGILPASIFCSGHTYFIQAMYQ
  QLRLEPYAVHTTFQYGGTEGKRHRL
Full Sequence
Protein Sequence     Length: 589     Download
MAWRKGFEEV ANSKPLFLTI YTVVIIGIVV SSFYVFSAIY SANPPSAQSS AWLSSISSDA    60
THVTDQTLNV SQSAAVHTVP PPSPRPRNES PRSIWDDPPP NKKMPPLKDF RLTKELVRQR    120
VKDNAIIVTF GNYAFMDFIL TWVKQLTDLG VSNFLVGAMD TKLLEALYWK GIPVFDMGSH    180
MSTVDVGWGS PTFHKMGREK VILIDSILPF GFELLMCDTD MVWLKNPLPY LARYPEADVL    240
TSSDQVIPTV VDDSLENWPE VSGAYNIGIF HWRPTESAKK LAKQWKEMLL ADDQIWDQNG    300
FNDIVHRQLG PSVDDESGLV FVFDGKLKLG ILPASIFCSG HTYFIQAMYQ QLRLEPYAVH    360
TTFQYGGTEG KRHRLREAMH FLDPPEYYNP LGGFLSFKPH IPKNLLLSGE HNVESHFTLV    420
NYQIKQIRAA LAIASLLNRT LVMPPLWCRI DRLWYPHPGI LEGSMTRQPF LCPLDHVFEV    480
NVMLKKLPEE EFGPQIDFRE YSILDNPSLP SEVKKSWLDV QLCKDGTQDC DASASNDTTV    540
GGVLKFPKHS NEEMFMKVFS SLKDVKVIKF STVQDAFTGK GRKIQKSC*                600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans3.0e-48151375231+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAH19600.1025794585AT2G35610 [Arabidopsis thaliana]
EMBLCBI29197.1075796583unnamed protein product [Vitis vinifera]
RefSeqNP_850250.1025794585unknown protein [Arabidopsis thaliana]
RefSeqXP_002328759.108157983579predicted protein [Populus trichocarpa]
RefSeqXP_002519934.1025793580reticulon3-A3, putative [Ricinus communis]
Transmembrane Domains
StartEnd
1537
124143
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT5119933011264260
EX1308722951944880
EV2351133021894900
GR7084012981374340
DT5670462851474310
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00317.5Aquca_011_00317.4Aquca_011_00317.3Aquca_011_00317.2Aquca_011_00317.1
Arabidopsis lyrata902666
Arabidopsis thalianaAT2G35610.1
Brachypodium distachyonBradi1g15410.1Bradi3g45950.1
Brassica rapaBra017310Bra005325
Carica papayaevm.model.supercontig_90.39
Capsella rubellaCarubv10022808m
Chlamydomonas reinhardtiig13982.t1g15149.t1Cre02.g082950.t1.3Cre01.g000400.t1.2Cre01.g000450.t1.2
g4580.t1Cre07.g340950.t1.3Cre04.g224350.t1.3Cre01.g000500.t1.3Cre09.g416650.t1.2
Cre13.g574100.t1.2Cre13.g574041.t1.1Cre13.g574050.t1.2Cre07.g332500.t1.2
Citrus clementinaCiclev10011269m
Citrus sinensisorange1.1g036925m
Cucumis sativusCucsa.018320.1Cucsa.018320.10Cucsa.018320.3
Eucalyptus grandisEucgr.E01147.2Eucgr.E01147.1
Fragaria vescamrna10921.1-v1.0-hybrid
Glycine maxGlyma11g09650.2Glyma01g35690.1Glyma16g08350.1Glyma16g20730.1Glyma16g08350.2
Gossypium raimondiiGorai.004G177500.4Gorai.008G219000.2Gorai.004G177500.5Gorai.004G177500.6Gorai.004G177500.7
Gorai.004G177500.9Gorai.004G177500.2Gorai.004G177500.3Gorai.004G177500.1Gorai.008G219000.1
Gorai.004G177500.8
Linum usitatissimumLus10005034Lus10027804
Malus domesticaMDP0000349223
Manihot esculentacassava4.1_003398mcassava4.1_008884m
Medicago truncatulaMedtr8g072310.1Medtr5g025590.1
Mimulus guttatusmgv1a002766m
Oryza sativaLOC_Os03g38930.1
Panicum virgatumPavirv00057126mPavirv00045617mPavirv00069114m
Physcomitrella patensPp1s46_165V6.1
Phaseolus vulgarisPhvul.003G278500.1Phvul.002G122000.1
Picea abiesMA_486176g0010MA_10433213g0010
Populus trichocarpaPotri.004G235800.1Potri.004G235800.2
Prunus persicappa002815m
Ricinus communis29827.m002651
Setaria italicaSi034728m
Selaginella moellendorffii127789
Sorghum bicolorSb01g015590.1
Thellungiella halophilaThhalv10016368m
Vitis viniferaGSVIVT01036881001
Volvox carteriVocar20007251mVocar20009385mVocar20010418mVocar20002020mVocar20004159m
Vocar20001219mVocar20001335mVocar20001723mVocar20006862mVocar20009663m
Vocar20008350mVocar20001348m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)