y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma16g09405.1
FamilyGT8
Protein PropertiesLength: 331 Molecular Weight: 38342.6 Isoelectric Point: 6.1315
ChromosomeChromosome/Scaffold: 16 Start: 9278862 End: 9291758
Descriptiongalacturonosyltransferase 7
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT8503022.1e-33
  NKSSHNDEKADEEKFIDSSLHHYVIFSNNVLAASVVWFLRNHYKEGVVQVLNVELDSQKENPLLLSLPEEFHISFCDNPSTNRIRTKYLSIFSESHYLLP
  HLFNNFNKVVVLEDDVVIQQDLFALWNIIWDTKLTVQFCSVKLGKLKSYLGEKGFSQNSYAWMSGLNIIDLVRWRELGLTQTYRKLIKEFTMQEGSIEGI
  AWRASLLTFENEIYPLNESWVVSGLGHDYTIDTQPINTASVLHYNGKMKPWLD
Full Sequence
Protein Sequence     Length: 331     Download
MENTISRVKS ILVGCDNVDN KLRQIFDLTE DEANFSLKHV HSAFLYKLNN KSSHNDEKAD    60
EEKFIDSSLH HYVIFSNNVL AASVVWFLRN HYKEGVVQVL NVELDSQKEN PLLLSLPEEF    120
HISFCDNPST NRIRTKYLSI FSESHYLLPH LFNNFNKVVV LEDDVVIQQD LFALWNIIWD    180
TKLTVQFCSV KLGKLKSYLG EKGFSQNSYA WMSGLNIIDL VRWRELGLTQ TYRKLIKEFT    240
MQEGSIEGIA WRASLLTFEN EIYPLNESWV VSGLGHDYTI DTQPINTASV LHYNGKMKPW    300
LDLGIPQYKS YWKKFLNKED QLLSECNVNS *                                   360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02910PLN029103.0e-451329415+
PLN02742PLN027423.0e-4550327332+
PLN02829PLN028292.0e-521329410+
cd06429GT8_like_14.0e-5570317283+
PLN02769PLN027691.0e-1561329388+
Gene Ontology
GO TermDescription
GO:0016757transferase activity, transferring glycosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABN08312.101330262645Glycosyl transferase, family 8 [Medicago truncatula]
EMBLCAN66549.1013271404hypothetical protein [Vitis vinifera]
EMBLCAQ58617.101329150540transferase, transferring glycosyl groups / unknown protein [Vitis vinifera]
RefSeqXP_002264525.101329228612PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002519984.101329191575Glycosyltransferase QUASIMODO1, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ga8_A0.00113630077252A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB1g9r_A0.00113630077252A Chain A, Crystal Structure Of Galactosyltransferase Lgtc In Complex With Mn And Udp-2f-Galactose
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan biosynthesis2.4.1.43-RXNEC-2.4.1.43polygalacturonate 4-α-galacturonosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO785449302513180
BG588402247923310
FG881569232873140
EV2631981711593270
FG8958531751593310
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00589.1Aquca_004_00589.4Aquca_004_00589.2Aquca_004_00589.3Aquca_004_00589.5
Aquca_004_00589.6Aquca_004_00589.7Aquca_004_00589.8Aquca_004_00589.9
Arabidopsis lyrata482874
Arabidopsis thalianaAT2G38650.1AT2G38650.2
Brachypodium distachyonBradi1g63520.1Bradi4g44070.1Bradi1g17570.1Bradi3g61120.1
Brassica rapaBra017110Bra005091Bra000081
Carica papayaevm.model.supercontig_63.51
Capsella rubellaCarubv10022827mCarubv10022960m
Citrus clementinaCiclev10011265mCiclev10011297m
Citrus sinensisorange1.1g006506morange1.1g006959morange1.1g010099m
Cucumis sativusCucsa.002900.3Cucsa.002900.1Cucsa.002900.4
Eucalyptus grandisEucgr.A00881.2Eucgr.A00881.1
Fragaria vescamrna13645.1-v1.0-hybrid
Glycine maxGlyma18g45226.1Glyma09g40610.2
Gossypium raimondiiGorai.005G129100.4Gorai.005G129100.5Gorai.005G129100.2Gorai.006G236100.1Gorai.006G236100.2
Gorai.006G236100.3Gorai.006G236100.4Gorai.005G129100.1Gorai.005G129100.3
Linum usitatissimumLus10003235Lus10035615
Malus domesticaMDP0000922484MDP0000174912
Manihot esculentacassava4.1_005865mcassava4.1_034453m
Medicago truncatulaMedtr7g074680.1
Mimulus guttatusmgv1a002878m
Oryza sativaLOC_Os11g03160.1LOC_Os03g21250.1LOC_Os07g48370.1LOC_Os05g40720.1LOC_Os12g02910.1
Panicum virgatumPavirv00000593mPavirv00014347mPavirv00006239mPavirv00024569mPavirv00069223m
Pavirv00024467mPavirv00048424mPavirv00040432mPavirv00034218mPavirv00014348m
Phaseolus vulgarisPhvul.008G076900.1
Picea abiesMA_118216g0010
Populus trichocarpaPotri.T138200.1Potri.016G144000.1Potri.016G144000.2Potri.006G114300.1Potri.006G114300.2
Potri.006G114300.3Potri.006G114300.4
Prunus persicappa002860m
Ricinus communis30073.m002205
Setaria italicaSi009553mSi029187mSi026080mSi021466mSi034649m
Sorghum bicolorSb09g023760.1Sb01g036430.1Sb02g043170.1Sb08g002010.1
Thellungiella halophilaThhalv10016387mThhalv10016389m
Vitis viniferaGSVIVT01029827001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)