y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma16g17075.1
FamilyGH1
Protein PropertiesLength: 169 Molecular Weight: 18919.4 Isoelectric Point: 8.5856
ChromosomeChromosome/Scaffold: 16 Start: 18342787 End: 18343908
Descriptionbeta glucosidase 17
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH111684.40008e-43
  VLPKGKLSACANHEGVNYYNNLINKLMANALEDEYGGFLSPHIVDDFRNYAELCFKEFGNGVKHWITLNEPRSVSKNGYANGKFAPGQCSDWLKLNCTGG
  DSGTEPHLTWRYQLLAHATTAKLYKTKYQASQKGLIGITLNSDWYMPVSKEKSDRDAARRGLDFMFGW
Full Sequence
Protein Sequence     Length: 169     Download
VLPKGKLSAC ANHEGVNYYN NLINKLMANA LEDEYGGFLS PHIVDDFRNY AELCFKEFGN    60
GVKHWITLNE PRSVSKNGYA NGKFAPGQCS DWLKLNCTGG DSGTEPHLTW RYQLLAHATT    120
AKLYKTKYQA SQKGLIGITL NSDWYMPVSK EKSDRDAARR GLDFMFGW*                180
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG2723BglB2.0e-2511168173+
PLN02998PLN029984.0e-351168183+
PLN02814PLN028142.0e-3612168172+
pfam00232Glyco_hydro_11.0e-371168184+
PLN02849PLN028493.0e-3812168172+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABV54754.101168102284beta-glucosidase-like protein [Trifolium repens]
GenBankABW76288.101168112294beta-glucosidase G3 [Medicago truncatula]
GenBankACD65511.101168124306beta-glucosidase D7 [Lotus japonicus]
Swiss-ProtP2620501168110292BGLT_TRIRP RecName: Full=Cyanogenic beta-glucosidase; AltName: Full=Linamarase; Flags: Precursor
RefSeqXP_002285582.101168118300PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1cbg_A0116899281A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB3ptq_B01168114296A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB3ptq_A01168114296A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB3ptm_B01168114296A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
PDB3ptm_A01168114296A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase
Metabolic Pathways
Pathway NameReactionECProtein Name
coumarin biosynthesis (via 2-coumarate)RXN-8036EC-3.2.1.21β-glucosidase
linamarin degradationRXN-5341EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-13602EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-5341EC-3.2.1.21β-glucosidase
lotaustralin degradationRXN-9674EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-13603EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-9674EC-3.2.1.21β-glucosidase
taxiphyllin bioactivationRXN-13600EC-3.2.1.21β-glucosidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FK00305718311680
FE71007118311680
HO042476173111680
BI31148518311680
CB89310518311680
Orthologous Group
SpeciesID
Carica papayaevm.TU.contig_28829.1
Glycine maxGlyma11g13791.1
Malus domesticaMDP0000198411
Manihot esculentacassava4.1_012507m
Picea abiesMA_6507007g0010MA_8474719g0010
Vitis viniferaGSVIVT01032022001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny