y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma16g17250.1
FamilyGT4
Protein PropertiesLength: 496 Molecular Weight: 55881.9 Isoelectric Point: 8.3707
ChromosomeChromosome/Scaffold: 16 Start: 18626779 End: 18628932
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT43154541.7e-24
  VLGVAGRLVKDKGHPLLHEAYSRLITKHPNVYLIVAGSGPWENRYRDLGSQVLVLGSMSPSMLRAFYNAIDIFVNPTLRPQGLDLTLMEAMMSGKPLLAS
  RFPSIKGTIVVDDEYGYMFSPNVESLQEALEAVVKEGPQR
Full Sequence
Protein Sequence     Length: 496     Download
MALNTTKSKK STSPSNFYFC TTLFFIVLFT IPVLFLLHAP TTTSICTTLA SSQAKTWSGD    60
LQLVEFAWNR LSFFEHNPSP FALKVAVFSR KWPIGTTPGG MERHAHTLHT ALARRGHQVH    120
VFTSPPEDES ISVSSSEVNE NKHQEGAPSS PYIHFHEGEP GRWRYNKAWE QFVEENQREP    180
FHVVHSESVA LPHWLARNMS NLAVSWHGIA LESLQSSIFQ DLTRRQDEPM SPLFNKSIQG    240
VVPKVLNEIR FFKNYAHHVA ISDSCGEMLR DVYQIPNRRV HVILNGVDED DFGEDVELGR    300
EFRTKIGIPG NASLVLGVAG RLVKDKGHPL LHEAYSRLIT KHPNVYLIVA GSGPWENRYR    360
DLGSQVLVLG SMSPSMLRAF YNAIDIFVNP TLRPQGLDLT LMEAMMSGKP LLASRFPSIK    420
GTIVVDDEYG YMFSPNVESL QEALEAVVKE GPQRLARRGK ACREYAAKMF TARKMALAYE    480
RLFLCIKDRS FCTYP*                                                    540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd03807GT1_WbnK_like4.0e-28250483243+
cd03811GT1_WabH_like2.0e-3099472384+
TIGR00032argG8.0e-3199482398+
cd03798GT1_wlbH_like9.0e-3699483398+
cd03801GT1_YqgM_like5.0e-5584483411+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002271072.103849537493PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002271108.1014951492PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002303479.1014941488predicted protein [Populus trichocarpa]
RefSeqXP_002326600.1014941487predicted protein [Populus trichocarpa]
RefSeqXP_002519899.1014952486glycosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3c4v_B0.00000039946622386A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
PDB3c4v_A0.00000039946622386A Chain A, Structure And Mechanisim Of Core 2 Beta1,6-N- Acetylglucosaminyltransferase: A Metal-Ion Independent Gt-A Glycosyltransferase
PDB3c4q_B0.00000039946622386A Chain A, Structure Of The Retaining Glycosyltransferase Msha : The First Step In Mycothiol Biosynthesis. Organism : Corynebacterium Glutamicum- Complex With Udp
PDB3c4q_A0.00000039946622386A Chain A, Structure Of The Retaining Glycosyltransferase Msha : The First Step In Mycothiol Biosynthesis. Organism : Corynebacterium Glutamicum- Complex With Udp
PDB3c48_B0.00000069946642406A Chain A, Structure Of The Retaining Glycosyltransferase Msha: The First Step In Mycothiol Biosynthesis. Organism: Corynebacterium Glutamicum- Apo (Open) Structure.
Transmembrane Domains
StartEnd
1739
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
AM7324152861764610
GR1862222611884480
FG1633432872094940
CO9850292262714960
GO0171281982984950
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_055_00071.1Aquca_004_00554.1
Arabidopsis lyrata316266919149492915
Arabidopsis thalianaAT1G73160.1AT5G59070.1AT4G19460.1
Brachypodium distachyonBradi2g45370.1
Brassica rapaBra012542Bra003857Bra013399Bra020331
Carica papayaevm.model.supercontig_305.3
Capsella rubellaCarubv10004612mCarubv10021524m
Citrus clementinaCiclev10008126mCiclev10003490m
Citrus sinensisorange1.1g039338morange1.1g044542m
Cucumis sativusCucsa.268510.1
Eucalyptus grandisEucgr.E01172.1Eucgr.F03250.1
Fragaria vescamrna27708.1-v1.0-hybridmrna27178.1-v1.0-hybrid
Glycine maxGlyma09g34990.1Glyma01g35440.1Glyma16g08210.1
Gossypium raimondiiGorai.009G372800.1Gorai.008G217900.1
Linum usitatissimumLus10032187Lus10014499Lus10033297Lus10034760
Malus domesticaMDP0000252217MDP0000510770MDP0000280727MDP0000690085
Manihot esculentacassava4.1_023608mcassava4.1_022788m
Medicago truncatulaMedtr5g026360.1Medtr8g071900.1
Mimulus guttatusmgv1a005617mmgv1a027119m
Oryza sativaLOC_Os01g46430.1
Panicum virgatumPavirv00039421mPavirv00050283m
Physcomitrella patensPp1s115_97V6.1Pp1s115_97V6.2Pp1s231_59V6.1
Phaseolus vulgarisPhvul.002G124600.1Phvul.003G277200.1
Picea abiesMA_159118g0690MA_58772g0010
Populus trichocarpaPotri.011G097000.1Potri.003G105500.1Potri.001G128300.1
Prunus persicappa004871mppa024212m
Ricinus communis30150.m00047029827.m002616
Setaria italicaSi001150m
Selaginella moellendorffii79637
Sorghum bicolorSb03g029770.1
Thellungiella halophilaThhalv10013459mThhalv10027268mThhalv10019571m
Vitis viniferaGSVIVT01036920001GSVIVT01036921001GSVIVT01036924001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny