y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma16g18930.1
FamilyCE10
Protein PropertiesLength: 478 Molecular Weight: 52641.8 Isoelectric Point: 8.6108
ChromosomeChromosome/Scaffold: 16 Start: 20828732 End: 20846503
Descriptionalpha/beta-Hydrolases superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE101794220
  RRSIVYGDKPRNRLDLYLPKNSNGPKPVVAFVTGGAWIIGYKAWGSLLGQQLSDRDIIVACIDYRNFPQGTISDMIVDASQGISFVCNNIAEYGGDPNRI
  YLMGQSAGAHIAACAIVEQAIKEAGEGESTSWSLSQIKTYFGLSGGYNLFTLIDHFHSRGLYRSIFLSIMEGEESLQRFSPEVMIQDPNIGNANSLLPPV
  VLFHGTGDYSIPSDASKTFAEALKRVGVTAESILYEGKTHTDVF
Full Sequence
Protein Sequence     Length: 478     Download
MPSQILPTPN YRALDSAVSS PPSMLLRAKV DDMDDDPSAS LLQHSPPSFQ EMSLNKPPLP    60
RASSFTTTTA TTTRSKGSHT RHCFYQKRRR RAASQDSLPS VSVDTASTTT TTTTTRSSFG    120
RDVASETFLL TRLGFKMLRY LGVGYKWITK FLALGCYAVL LFPGFIQVGY YYFFSKQIRR    180
SIVYGDKPRN RLDLYLPKNS NGPKPVVAFV TGGAWIIGYK AWGSLLGQQL SDRDIIVACI    240
DYRNFPQGTI SDMIVDASQG ISFVCNNIAE YGGDPNRIYL MGQSAGAHIA ACAIVEQAIK    300
EAGEGESTSW SLSQIKTYFG LSGGYNLFTL IDHFHSRGLY RSIFLSIMEG EESLQRFSPE    360
VMIQDPNIGN ANSLLPPVVL FHGTGDYSIP SDASKTFAEA LKRVGVTAES ILYEGKTHTD    420
VFLQDPMRGG KDDMFEDLVA YIHSGDADAR ARDATAPPRR RLVPEFMLKL AHSVSPF*      480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00135COesterase4.0e-9194291126+
COG2272PnbA2.0e-10192291114+
COG1506DAP24.0e-11194418244+
pfam07859Abhydrolase_31.0e-11212418212+
COG0657Aes2.0e-24179418246+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_173937.2014771476esterase-related [Arabidopsis thaliana]
RefSeqXP_002264962.1011647753417PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002277990.105647752458PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002315969.1014771517predicted protein [Populus trichocarpa]
RefSeqXP_002514516.1012447792445catalytic, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2hm7_A0.000000000319141861282A Chain A, Crystal Structure Analysis Of The G84s Est2 Mutant
PDB1evq_A0.000000000419141861282A Chain A, The Crystal Structure Of The Thermophilic Carboxylesterase Est2 From Alicyclobacillus Acidocaldarius
PDB1u4n_A0.00000000119141861282A Chain A, The Crystal Structure Of The Thermophilic Carboxylesterase Est2 From Alicyclobacillus Acidocaldarius
PDB1qz3_A0.00000000119141861282A Chain A, Crystal Structure Of Mutant M211sR215L OF CARBOXYLESTERASE Est2 Complexed With Hexadecanesulfonate
PDB2c7b_B0.00000000319141861281A Chain A, The Crystal Structure Of Este1, A New Thermophilic And Thermostable Carboxylesterase Cloned From A Metagenomic Library
Transmembrane Domains
StartEnd
151173
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GE4792562991454420
DY277968376824450
DV9948322811454240
DY280956316863980
FC901726287823640
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01054.1Aquca_026_00158.1Aquca_002_01054.2Aquca_002_01054.3
Arabidopsis lyrata472805488435871523
Arabidopsis thalianaAT5G15860.1AT3G02410.2AT3G02410.1AT1G26120.1AT5G15860.2
Brachypodium distachyonBradi2g44942.1Bradi1g34707.1Bradi2g15577.1
Brassica rapaBra023542Bra039174Bra024729Bra011010
Carica papayaevm.model.supercontig_179.40evm.model.supercontig_1.241
Capsella rubellaCarubv10009035mCarubv10013836mCarubv10001044m
Chlamydomonas reinhardtiiCre02.g119050.t1.3Cre02.g119100.t1.2Cre04.g221000.t1.2
Citrus clementinaCiclev10031407mCiclev10012228mCiclev10012226mCiclev10011876mCiclev10031505m
Ciclev10032121m
Citrus sinensisorange1.1g011866morange1.1g021014morange1.1g015512morange1.1g015857morange1.1g015669m
orange1.1g012898morange1.1g027370morange1.1g020616m
Cucumis sativusCucsa.284050.2Cucsa.284050.1Cucsa.031590.2Cucsa.031590.1Cucsa.031590.3
Cucsa.023750.1
Eucalyptus grandisEucgr.J01457.1Eucgr.B03069.1Eucgr.B03069.3Eucgr.B03069.2
Fragaria vescamrna10342.1-v1.0-hybridmrna04471.1-v1.0-hybrid
Glycine maxGlyma19g05450.1
Gossypium raimondiiGorai.013G079100.1Gorai.001G082500.7Gorai.001G082500.4Gorai.001G082500.3Gorai.001G082500.2
Gorai.001G082500.10Gorai.001G082500.1Gorai.001G082500.5Gorai.001G082500.8Gorai.001G082500.6
Gorai.013G079100.2Gorai.001G082500.9Gorai.001G082500.11
Linum usitatissimumLus10034399Lus10034083Lus10035064Lus10003065Lus10017889
Lus10019156
Malus domesticaMDP0000150270MDP0000199618MDP0000148927
Manihot esculentacassava4.1_007743mcassava4.1_008765m
Medicago truncatulaAC233657_38.1
Mimulus guttatusmgv1a005715mmgv1a006071mmgv1a007008m
Oryza sativaLOC_Os06g49440.1LOC_Os05g50170.2LOC_Os05g50170.1LOC_Os01g45460.1
Panicum virgatumPavirv00062556mPavirv00037181mPavirv00069964mPavirv00069963mPavirv00008713m
Pavirv00033569mPavirv00037182mPavirv00029918m
Physcomitrella patensPp1s196_45V6.1Pp1s62_226V6.1Pp1s74_172V6.1Pp1s131_174V6.1
Phaseolus vulgarisPhvul.003G282000.1Phvul.002G197000.1
Picea abiesMA_10277324g0010
Populus trichocarpaPotri.004G104800.4Potri.004G104800.2Potri.004G104800.1Potri.T099800.1Potri.017G110700.2
Potri.017G110700.1Potri.010G132200.3Potri.010G132200.2Potri.010G132200.1Potri.004G104800.3
Potri.010G132200.4Potri.004G104800.5
Prunus persicappa006567mppa005357m
Ricinus communis28583.m00011030138.m00382932825.m000025
Setaria italicaSi006248mSi001677mSi001674mSi025328m
Selaginella moellendorffii17024680622
Sorghum bicolorSb10g029410.1Sb03g029280.1
Thellungiella halophilaThhalv10013599mThhalv10020771mThhalv10007556m
Vitis viniferaGSVIVT01030706001GSVIVT01012000001
Volvox carteriVocar20003581mVocar20003648m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)