y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma16g19096.1
FamilyGT1
Protein PropertiesLength: 223 Molecular Weight: 25592.6 Isoelectric Point: 5.5993
ChromosomeChromosome/Scaffold: 16 Start: 20872252 End: 20873202
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT1481984.9e-25
  ECLKWLDSQELNLVLYVNFGNVIVMRHQQLVELAWGLANSKKKFMWVIRPDLVEGEASILPPEIVEETKDKGLLVEQVLKHPIVAGFLTHCGWNSMLESI
  TNRVPLICCPFFNHQTLNCRYISREWAFGMEMDSHNVTRAEVEKLVKELLE
Full Sequence
Protein Sequence     Length: 223     Download
ENYLTNGHLD STINWIPGLK NITLRDLVGI YQSTFDSIKC YLWKEECECL KWLDSQELNL    60
VLYVNFGNVI VMRHQQLVEL AWGLANSKKK FMWVIRPDLV EGEASILPPE IVEETKDKGL    120
LVEQVLKHPI VAGFLTHCGW NSMLESITNR VPLICCPFFN HQTLNCRYIS REWAFGMEMD    180
SHNVTRAEVE KLVKELLEAT HTNGSSVLNL EKQVNELLFV KT*                      240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03004PLN030043.0e-2745180147+
PLN02992PLN029925.0e-2950180154+
PLN02448PLN024482.0e-3045179140+
PLN02410PLN024104.0e-3542187157+
PLN02555PLN025551.0e-3648179139+
Gene Ontology
GO TermDescription
GO:0008152metabolic process
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN60444.109221230468hypothetical protein [Vitis vinifera]
RefSeqXP_002263100.109221224462PREDICTED: hypothetical protein isoform 2 [Vitis vinifera]
RefSeqXP_002525850.101221171478UDP-glucuronosyltransferase, putative [Ricinus communis]
RefSeqXP_002525852.101219171470UDP-glucuronosyltransferase, putative [Ricinus communis]
RefSeqXP_002530115.104221178482UDP-glucuronosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pq6_A024218262478A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2pq6_A0.00009134173206A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vg8_A1e-3545216254444A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vch_A1e-3545216254444A Chain A, Crystal Structure Of Medicago Truncatula Ugt85h2- Insights Into The Structural Basis Of A Multifunctional (Iso) Flavonoid Glycosyltransferase
PDB2vce_A1e-3545216254444A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
Metabolic Pathways
Pathway NameReactionECProtein Name
cytokinins-O-glucoside biosynthesisRXN-4723EC-2.4.1.203trans-zeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4726EC-2.4.1UDP-glucose:dihydrozeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4735EC-2.4.1.215cis-zeatin O-β-D-glucosyltransferase
cytokinins-O-glucoside biosynthesisRXN-4737EC-2.4.1dihydrozeatin-9-N-glucoside O-β-D-glucosyltransferase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CB829602162301860
EC944563155371860
EC922707162301860
DR919359216302190
DT758922216302190
Orthologous Group
SpeciesID
Manihot esculentacassava4.1_021147m
Setaria italicaSi019477m
Vitis viniferaGSVIVT01009050001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny