y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma16g22488.1
FamilyGH28
Protein PropertiesLength: 481 Molecular Weight: 53957.5 Isoelectric Point: 4.9069
ChromosomeChromosome/Scaffold: 16 Start: 25974090 End: 25978329
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH282914146.5e-34
  DTPDFDLSLNNITIRGKGVIDGQGSVWWNNDSPTYNPTEVMLESKGRLPSTKPTLKALRFYGSDGVTVTCITIQNSQQTHLKFDSCTNVQVSGISVSSPG
  DSPNTDGIHLQNSQNVVIYSSTLA
Full Sequence
Protein Sequence     Length: 481     Download
MHYLVVVLAL NRVSLFGLGL GLARCGKSCR LRWLNYLRPN LKIGNYTEEE EETIIKLHRH    60
LAKILKVILA KEELSLDVDL DAVASMTDGY SRSDLKVPGF LFPVTLFFEI KVTIIQYLML    120
ALILQNLCIT AVDRPIKEIL EKEKKVSTEW PGFPLGVKFD PSDVELLECL AAKCGIGNTQ    180
QHMFINEFIP TLEGDQGICY THPKNLPDIQ DQDFPGNAAW LAGESRAEEN TKYDGCDDVL    240
LCKEILDSSA ILNDPGLDST NLEDIADYAT QRARNDHESW GISILDSLEL DTPDFDLSLN    300
NITIRGKGVI DGQGSVWWNN DSPTYNPTEV MLESKGRLPS TKPTLKALRF YGSDGVTVTC    360
ITIQNSQQTH LKFDSCTNVQ VSGISVSSPG DSPNTDGIHL QNSQNVVIYS STLACEKREI    420
ELLSTLLKSN EVDPPSRDEK LRNERIYKFY QHNRNPFVDH PKYAILIWKQ PVFHQLTNIV    480
*                                                                    540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN03091PLN030916.0e-13105857+
PLN02188PLN021882.0e-14299414117+
PLN02793PLN027931.0e-16299413115+
PLN02218PLN022185.0e-20299413118+
pfam00295Glyco_hydro_287.0e-24298412115+
Gene Ontology
GO TermDescription
GO:0004518nuclease activity
GO:0004650polygalacturonase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAD46483.10273415114248polygalacturonase PG1 [Glycine max]
GenBankAAD46484.10273415110244polygalacturonase PG2 [Glycine max]
GenBankAAO24262.11.99965e-42280422159295putative style polygalacturonase [Turnera subulata]
GenBankACU24545.10273415114248unknown [Glycine max]
DDBJBAH56488.19.94922e-44280415176313polygalacturonase 1 [Prunus persica]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1msf_C0.0000723733690A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
PDB1mse_C0.0000723733690C Chain C, Solution Structure Of A Specific Dna Complex Of The Myb Dna- Binding Domain With Cooperative Recognition Helices
PDB1gv2_A0.0000823623675A Chain A, Crystal Structure Of C-Myb R2r3
PDB1h8a_C0.000123625998C Chain C, Crystal Structure Of Ternary Protein-Dna Complex3
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FG992538972083040
FG992538661462110
BI7845781063134180
BI7845771063134180
FG992538221241451.9
Orthologous Group
SpeciesID
Brassica rapaBra014620
Glycine maxGlyma09g26905.1
Populus trichocarpaPotri.001G108000.1
Prunus persicappb019654m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny