y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma16g25710.2
FamilyPL1
Protein PropertiesLength: 360 Molecular Weight: 40514.6 Isoelectric Point: 8.675
ChromosomeChromosome/Scaffold: 16 Start: 29753500 End: 29755230
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
PL1802790
  WITFQRDMHIRLEKPLLISSFTTIDGRGVNVHIVDNACLMIFKATNIIIHGLRIHHCRPQAPGMVMGPNGEVIPLGQVDGDAIRLVTASKIWIDHNTLYD
  CQDGLLDVTRGSTNVTISNNWFREQNKVMLLGHDDGYMRDKDMMVTVVYNYFGPNCHQRMPRIRHGYAHVANNLYMGWVQYAIGGSMEPSLKSESNLFIA
Full Sequence
Protein Sequence     Length: 360     Download
MTYQVINYIL WCFVLAVVSV TMFNPKVSSA SKQSKLEGLE MNEIDQCWRL NPEWRKHRSQ    60
LAKCSVGYVG KMTNNIGKVW ITFQRDMHIR LEKPLLISSF TTIDGRGVNV HIVDNACLMI    120
FKATNIIIHG LRIHHCRPQA PGMVMGPNGE VIPLGQVDGD AIRLVTASKI WIDHNTLYDC    180
QDGLLDVTRG STNVTISNNW FREQNKVMLL GHDDGYMRDK DMMVTVVYNY FGPNCHQRMP    240
RIRHGYAHVA NNLYMGWVQY AIGGSMEPSL KSESNLFIAP TSGRKEVTWR KSNGIGDSWE    300
FHSVGDVFEN GASFMETQGG QVPKPNYNPE QSFKVVDAKC VRSLTISSGV LRCSKTSIC*    360
                                                                     420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3866PelB2.0e-2797294223+
pfam00544Pec_lyase_C1.0e-5599277187+
smart00656Amb_all1.0e-6686280206+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI26401.107335934320unnamed protein product [Vitis vinifera]
RefSeqXP_002267384.104135919369PREDICTED: similar to putative Cup s 1 pollen allergen [Vitis vinifera]
RefSeqXP_002299118.10413591354predicted protein [Populus trichocarpa]
RefSeqXP_002304865.10413591352predicted protein [Populus trichocarpa]
RefSeqXP_002527354.10132876307Major pollen allergen Jun v 1 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1pxz_B0423512345A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pxz_A0423512345A Chain A, 1.7 Angstrom Crystal Structure Of Jun A 1, The Major Allergen From Cedar Pollen
PDB1pcl_A0.0000000000000027727761276A Chain A, Unusual Structural Features In The Parallel Beta-Helix In Pectate Lyases
PDB3zsc_A0.0000000000000057126840227A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
PDB3vmw_A0.0000000000000110234382314A Chain A, Catalytic Function And Substrate Recognition Of The Pectate Lyase From Thermotoga Maritima
Transmembrane Domains
StartEnd
523
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT5757502241313540
FD757999214933060
FG4742491951643570
FG4786481951643570
DR808308255422570
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_035_00024.1Aquca_018_00074.1Aquca_015_00229.1
Arabidopsis lyrata487738881338
Arabidopsis thalianaAT5G09280.1AT1G30350.1
Brassica rapaBra009375Bra012756
Carica papayaevm.model.supercontig_42.185evm.model.supercontig_51.17
Capsella rubellaCarubv10002943mCarubv10006459m
Citrus sinensisorange1.1g041616m
Cucumis sativusCucsa.112490.1
Eucalyptus grandisEucgr.K02336.1
Fragaria vescamrna29291.1-v1.0-hybrid
Glycine maxGlyma11g06761.1Glyma01g38540.1Glyma13g21880.2
Gossypium raimondiiGorai.010G196700.1Gorai.010G196900.1Gorai.010G197000.1Gorai.010G197100.1Gorai.010G197400.1
Gorai.008G271800.1Gorai.008G271900.1Gorai.010G197600.1Gorai.010G197500.1Gorai.004G231500.1
Gorai.010G196800.1Gorai.010G197300.1
Linum usitatissimumLus10031867Lus10031296
Malus domesticaMDP0000244018MDP0000233331MDP0000166129
Manihot esculentacassava4.1_026008mcassava4.1_024289mcassava4.1_025601mcassava4.1_023158m
Medicago truncatulaMedtr6g077900.1Medtr8g078350.1Medtr5g035840.1Medtr5g019060.1Medtr4g064420.1
Medtr3g030900.1Medtr8g078310.1Medtr8g078390.1Medtr8g078280.1Medtr5g019090.1
Medtr5g019170.1Medtr5g019160.1
Mimulus guttatusmgv1a021987m
Oryza sativaLOC_Os08g18970.1
Panicum virgatumPavirv00017566m
Physcomitrella patensPp1s385_14V6.1Pp1s45_65V6.1
Phaseolus vulgarisPhvul.004G101900.1Phvul.002G025800.1Phvul.004G098100.1Phvul.004G101600.1
Picea abiesMA_10433764g0010
Populus trichocarpaPotri.003G218200.1Potri.001G007400.1Potri.003G218200.2Potri.005G064500.2Potri.005G064500.1
Prunus persicappa016145mppa021860mppa016917mppa025917mppa016255m
Ricinus communis29596.m00070329743.m000300
Setaria italicaSi013945m
Selaginella moellendorffii88799
Sorghum bicolorSb03g036930.1
Thellungiella halophilaThhalv10015832m
Vitis viniferaGSVIVT01024239001
Zea maysAC233851.1_FGT011
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny