y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma16g26800.4
FamilyCBM43
Protein PropertiesLength: 397 Molecular Weight: 43024.7 Isoelectric Point: 5.2732
ChromosomeChromosome/Scaffold: 16 Start: 30864853 End: 30869343
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM433113907.9e-31
  CVAKSNADSKMLQAALDWACGPGKVDCSPLLQGQSCYEPNSVASHATYAINSYYQQMAKSAGTCDFKGVASITTTNPSKE
GH17322920
  LGIGQSNATAANWVARNVIAHVPATNITAIAVGSEVLTSLPNAAPVLVSALKFIQAALVAANLDQQIKVSTPHSSSVILDSFPPSQAFFNKTWDPVMVPL
  LNFLQSTGSYLMLNVYPYYDYMQSNGVVPLDYALFRPLPPNKEAIDSNTLLHYTNVFDAIVDAAYFAMSYLKFTNIPILVTESGWPSKGDSSEPDATVDN
  ANTYNSNLIRHVLNNSGTPKQPGIAVSTYIYELYNEDLKSGPVSENNWGLFYASGAQVYTL
Full Sequence
Protein Sequence     Length: 397     Download
MEMLSLVSTL VQMSPTCQVQ QRLLPFLRLK ILGIGQSNAT AANWVARNVI AHVPATNITA    60
IAVGSEVLTS LPNAAPVLVS ALKFIQAALV AANLDQQIKV STPHSSSVIL DSFPPSQAFF    120
NKTWDPVMVP LLNFLQSTGS YLMLNVYPYY DYMQSNGVVP LDYALFRPLP PNKEAIDSNT    180
LLHYTNVFDA IVDAAYFAMS YLKFTNIPIL VTESGWPSKG DSSEPDATVD NANTYNSNLI    240
RHVLNNSGTP KQPGIAVSTY IYELYNEDLK SGPVSENNWG LFYASGAQVY TLHLTNSGTV    300
FANDTTNQTF CVAKSNADSK MLQAALDWAC GPGKVDCSPL LQGQSCYEPN SVASHATYAI    360
NSYYQQMAKS AGTCDFKGVA SITTTNPSKE SFFTYS*                             420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG5309COG53094.0e-620528585+
pfam07983X82.0e-2130938178+
smart00768X87.0e-3630939183+
pfam00332Glyco_hydro_172.0e-6931292270+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN82488.103039147408hypothetical protein [Vitis vinifera]
EMBLCBI26850.103039180441unnamed protein product [Vitis vinifera]
RefSeqXP_002312452.103039161422predicted protein [Populus trichocarpa]
RefSeqXP_002314794.103039175436predicted protein [Populus trichocarpa]
RefSeqXP_002527772.103039180441Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A02129449312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3ur8_B03929468314A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3ur8_A03929468314A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3ur7_B03929468314A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
PDB3ur7_A03929468314A Chain A, Higher-density Crystal Structure Of Potato Endo-1,3-beta-glucanase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DR951683280303090
GE476981314443570
GO3714672901023910
DV998179303443460
HS258579258302870
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00306.1Aquca_034_00008.2Aquca_034_00008.1Aquca_057_00054.1Aquca_005_00012.2.387.468
Aquca_005_00012.1.387.468Aquca_029_00060.1Aquca_005_00012.3.387.465Aquca_003_00345.1Aquca_042_00173.1.359.441
Aquca_022_00096.1Aquca_032_00084.2.385.463Aquca_032_00084.1.386.464Aquca_032_00084.5.385.461Aquca_020_00396.2.385.464
Aquca_032_00084.4.385.467Aquca_032_00084.3.386.468Aquca_020_00396.1.385.467Aquca_028_00029.2.380.458Aquca_028_00029.3.368.451
Aquca_028_00029.1.380.463Aquca_091_00065.2.363.444Aquca_091_00065.1.363.444Aquca_009_00463.1.361.442Aquca_004_00485.1.286.364
Aquca_004_00728.1.368.449Aquca_005_00103.2Aquca_005_00103.1Aquca_004_00728.2.368.447Aquca_057_00058.1
Aquca_005_00256.1
Arabidopsis lyrata496849484077.361.442495603.373.456478745.363.444879428.382.459
913572.392.474867248480193.385.468327458329002.368.451
894267.367.448870710879141869363881229
915703899301477115493553918818.369.451
Arabidopsis thalianaAT5G56590.1.369.451AT1G09460.1AT4G13600.1AT5G67460.1AT1G11820.2.382.463
AT2G01630.1.361.442AT3G13560.3.363.444AT3G13560.2.363.444AT3G13560.1.363.444AT1G29380.1
AT4G26830.1.367.450AT4G29360.1.391.473AT3G58100.1AT4G29360.2.391.470AT2G05790.1.384.467
AT4G05430.1AT5G55180.2.372.450AT1G66250.1.369.450AT5G55180.1.372.455AT2G30933.2
AT2G30933.1AT5G35740.1AT2G04910.1AT2G04910.2AT1G79480.2
AT1G79480.1
Brachypodium distachyonBradi1g58357.1Bradi3g57610.1.407.490Bradi4g26820.1Bradi2g15280.1Bradi1g26510.1.392.473
Bradi1g25530.1.374.454Bradi1g25530.1.374.454Bradi1g25517.1.474.556Bradi1g25517.1.474.556Bradi1g25517.1.388.464
Bradi1g25517.1.388.464Bradi1g25530.1.461.542Bradi1g25530.1.461.542Bradi2g49330.2.366.448Bradi2g49330.1.366.448
Bradi1g69610.1.364.445Bradi1g23640.1.373.454Bradi1g39060.1Bradi1g61320.1.241.322Bradi1g20370.1
Bradi2g26406.1Bradi5g21510.1Bradi1g31870.1Bradi1g02750.1Bradi3g43830.1
Bradi2g44390.1Bradi2g50750.1Bradi1g22290.1Bradi4g03190.1Bradi2g20070.1
Bradi3g15940.1
Brassica rapaBra035561.372.455Bra021679Bra032719Bra008414Bra027421.367.448
Bra031835Bra016812.386.467Bra019084.405.488Bra026644.361.442Bra011100.357.439
Bra004688Bra010330.377.459Bra020023Bra034233Bra002805.355.437
Bra015166.385.468Bra039757.370.451Bra028988.487.570Bra030780Bra003318
Bra002927.374.453Bra032314Bra035382Bra010831Bra035122
Carica papayaevm.model.supercontig_50.88evm.model.supercontig_152.27.385.463evm.model.supercontig_209.11evm.model.supercontig_6.30evm.model.supercontig_2.222.352.433
evm.model.supercontig_17.124evm.model.supercontig_136.19evm.model.supercontig_132.21.373.455evm.model.supercontig_48.219evm.model.supercontig_116.58.361.439
evm.model.supercontig_2750.1evm.model.supercontig_8.263evm.model.supercontig_32.84evm.model.supercontig_83.1evm.model.supercontig_12.252.372.456
evm.model.supercontig_78.32.367.449
Capsella rubellaCarubv10026261m.371.453Carubv10009486mCarubv10005790mCarubv10027495mCarubv10012467m.346.427
Carubv10026374m.369.452Carubv10019481m.361.442Carubv10004853m.344.427Carubv10007158m.393.475Carubv10013604m.387.470
Carubv10002833mCarubv10019942m.504.585Carubv10024176mCarubv10013514m.363.444Carubv10024005m
Carubv10006360mCarubv10015550mCarubv10015739mCarubv10011350mCarubv10020684m
Carubv10016031mCarubv10019163m
Citrus clementinaCiclev10006028mCiclev10005883mCiclev10014440m.182.263Ciclev10025640m.348.430Ciclev10008176m.385.468
Ciclev10016863mCiclev10018075mCiclev10008080m.367.449Ciclev10015086m.392.474Ciclev10014990m.362.443
Ciclev10011380mCiclev10011295mCiclev10016513mCiclev10017213mCiclev10015028m.362.443
Ciclev10011549m.361.442Ciclev10015027m.362.443Ciclev10017199mCiclev10013846mCiclev10022230m
Ciclev10032559mCiclev10005428m
Citrus sinensisorange1.1g048481morange1.1g036155morange1.1g030415morange1.1g010394m.369.450orange1.1g012052m.384.467
orange1.1g011551m.384.462orange1.1g011895m.384.463orange1.1g013292m.367.445orange1.1g010782m.367.449orange1.1g009301m.452.532
orange1.1g010833m.362.443orange1.1g006966morange1.1g048380morange1.1g047041morange1.1g011132m.362.443
orange1.1g011131m.362.443orange1.1g010931m.361.442orange1.1g033379morange1.1g040368morange1.1g029395m
orange1.1g028392m
Cucumis sativusCucsa.367120.1Cucsa.085740.1.380.461Cucsa.185010.2Cucsa.042790.1.370.453Cucsa.185010.1
Cucsa.166770.2Cucsa.166770.1Cucsa.185070.1.388.467Cucsa.212490.1Cucsa.120380.1
Cucsa.185070.2.254.337Cucsa.029930.2.328.409Cucsa.029930.1.361.442Cucsa.029930.3.361.437Cucsa.006230.2.346.428
Cucsa.006230.1.368.450Cucsa.047450.1Cucsa.118190.1Cucsa.355790.1.360.441Cucsa.153140.1.364.440
Cucsa.355790.4.360.438Cucsa.355790.3.360.438Cucsa.355790.2.360.438Cucsa.050890.1Cucsa.180520.1
Cucsa.113180.2Cucsa.113180.1Cucsa.058280.1Cucsa.239920.1Cucsa.193950.1
Cucsa.193950.2Cucsa.288710.2.291.373Cucsa.288710.1.369.448
Eucalyptus grandisEucgr.A00950.1Eucgr.H01316.2Eucgr.D01339.1.381.462Eucgr.H04823.1Eucgr.E04042.1.393.474
Eucgr.D01339.2.381.458Eucgr.A01095.2.386.468Eucgr.A01095.1.389.471Eucgr.A01979.1Eucgr.G02118.1.362.443
Eucgr.F03495.1.368.450Eucgr.C03710.1.366.448Eucgr.K00648.1Eucgr.E02359.1Eucgr.F02860.2.365.446
Eucgr.F02860.1.365.446Eucgr.B03614.1.362.444Eucgr.H01316.1Eucgr.K01086.1Eucgr.G02674.1
Eucgr.D01439.1
Fragaria vescamrna06678.1-v1.0-hybridmrna24890.1-v1.0-hybridmrna05734.1-v1.0-hybridmrna24806.1-v1.0-hybrid.319.401mrna30530.1-v1.0-hybrid.370.451
mrna19637.1-v1.0-hybrid.571.652mrna01212.1-v1.0-hybrid.390.473mrna00118.1-v1.0-hybridmrna19809.1-v1.0-hybridmrna21593.1-v1.0-hybrid
mrna22924.1-v1.0-hybridmrna03446.1-v1.0-hybrid.376.459mrna18474.1-v1.0-hybridmrna28713.1-v1.0-hybridmrna17802.1-v1.0-hybrid
mrna11332.1-v1.0-hybrid.366.448mrna22713.1-v1.0-hybridmrna25805.1-v1.0-hybrid
Glycine maxGlyma20g06250.2Glyma09g11676.2Glyma09g11676.1Glyma15g23435.1Glyma08g11810.2
Glyma08g11810.1Glyma05g28691.1Glyma11g05230.1Glyma07g39140.5.381.462Glyma07g39140.4.381.462
Glyma07g39140.3.381.462Glyma19g41371.1Glyma01g40060.1.308.390Glyma17g01601.2.404.485Glyma17g01601.1.404.485
Glyma15g11560.1.199.282Glyma03g38770.2Glyma18g04560.1.361.442Glyma14g39510.4.328.409Glyma14g39510.2.413.494
Glyma02g41190.1.362.443Glyma11g36490.1Glyma02g43640.1.384.467Glyma14g05300.1.383.466Glyma05g28700.1
Glyma02g45470.1Glyma08g12020.1.362.443Glyma17g29820.4.362.443Glyma17g29820.3.362.443Glyma17g29820.2.362.443
Glyma05g28870.1.362.443Glyma14g16630.2.365.446Glyma12g33610.1Glyma06g43741.1Glyma18g12770.1
Glyma14g03221.1Glyma16g26800.6.239.320Glyma16g26800.3.311.392Glyma16g26800.1.328.409Glyma08g42200.1
Glyma13g36860.2Glyma05g29810.2Glyma05g29790.2Glyma08g13690.2Glyma08g13690.1
Glyma05g30540.3Glyma05g30540.2Glyma16g26800.4.311.390Glyma14g01030.1Glyma08g12910.1
Glyma16g26800.7.239.316Glyma16g26800.5.311.388Glyma16g26800.2.328.405Glyma02g07730.1.361.442Glyma02g47620.1
Glyma08g12910.2Glyma08g04780.2.365.446Glyma05g34930.2.360.441Glyma05g35955.1.366.448Glyma08g03670.1.366.448
Glyma17g01140.1Glyma07g39671.1Glyma11g33650.1.361.442Glyma14g39510.3.413.491Glyma20g22525.1
Glyma10g28475.1Glyma14g02350.1.373.456Glyma02g46330.1.384.467Glyma08g42200.2Glyma15g41630.2
Glyma08g17511.1Glyma12g14156.1Glyma13g36860.1Glyma13g36860.3
Gossypium raimondiiGorai.005G032500.2Gorai.005G032500.1Gorai.011G156800.1Gorai.009G179400.2.384.465Gorai.009G179400.1.384.465
Gorai.008G082600.3.317.399Gorai.008G082600.2.330.412Gorai.008G082600.1.330.409Gorai.005G034300.1Gorai.004G064200.1.361.442
Gorai.002G092600.2.382.465Gorai.002G092600.1.382.465Gorai.009G442700.1.381.464Gorai.001G216900.5.248.331Gorai.001G216900.4.381.464
Gorai.001G216900.3.381.464Gorai.001G216900.2.381.464Gorai.011G124300.1Gorai.001G216900.1.381.460Gorai.002G174100.3.328.409
Gorai.002G174100.1.361.442Gorai.009G179400.3.384.463Gorai.006G093900.2Gorai.006G093900.1Gorai.009G028300.2.392.474
Gorai.009G028300.1.392.470Gorai.009G028200.1.457.539Gorai.009G028200.1.457.539Gorai.009G028200.1.361.443Gorai.009G028200.1.361.443
Gorai.008G047800.2Gorai.008G047800.1Gorai.009G157700.1Gorai.004G282300.2.365.445Gorai.009G443100.1
Gorai.004G282300.1.365.447Gorai.012G041000.2Gorai.012G041000.1Gorai.010G078300.1.366.448Gorai.001G192500.1
Gorai.001G204900.2.463.541Gorai.001G204900.1.463.544Gorai.002G174100.2.361.438Gorai.010G188600.1Gorai.005G159100.2.361.442
Gorai.005G159100.1.361.442Gorai.004G094500.1.361.442Gorai.010G126400.5.362.443Gorai.010G126400.4.326.407Gorai.010G126400.3.326.407
Gorai.010G126400.2.362.443Gorai.010G126400.1.362.443Gorai.008G198500.2Gorai.008G198500.1Gorai.001G093900.1
Gorai.011G159900.1Gorai.005G131400.1Gorai.001G214500.1Gorai.007G309000.3Gorai.007G309000.2
Gorai.007G309000.1Gorai.007G309000.5Gorai.007G309000.4
Linum usitatissimumLus10012937.297.379Lus10003803Lus10032601Lus10034987.303.385Lus10038529
Lus10023276Lus10020765Lus10007342Lus10031456.389.470Lus10002466
Lus10015151.388.471Lus10004391.370.452Lus10001516Lus10018306.381.463Lus10031443
Lus10040600.377.459Lus10034607.328.409Lus10032562.368.451Lus10012324Lus10004044.372.453
Lus10002295.372.453Lus10013465.362.443Lus10007929.328.409Lus10039179.383.464Lus10013758.327.404
Lus10010478Lus10004600Lus10004546Lus10038801Lus10039059
Lus10001167Lus10015259Lus10025379Lus10001764Lus10000278
Lus10002193Lus10039907
Malus domesticaMDP0000258920MDP0000905924MDP0000824147MDP0000193664MDP0000660874.390.473
MDP0000171994MDP0000299794MDP0000232219.447.529MDP0000630545.371.451MDP0000189637
MDP0000759591.375.453MDP0000295562.375.453MDP0000153096MDP0000646125.377.460MDP0000311086
MDP0000302259.282.364MDP0000120761.362.441MDP0000271262.362.438MDP0000251002.620.696MDP0000319911.615.691
MDP0000306824MDP0000258077MDP0000923219MDP0000319928MDP0000132451
MDP0000134087MDP0000528781MDP0000250892MDP0000495405MDP0000149001
MDP0000238659MDP0000166019MDP0000134605MDP0000261512MDP0000508660
MDP0000208614MDP0000128656MDP0000325237MDP0000258481MDP0000321326.481.540
Manihot esculentacassava4.1_015507mcassava4.1_031687mcassava4.1_030523m.360.441cassava4.1_016834mcassava4.1_021465m.388.469
cassava4.1_031379mcassava4.1_008433m.333.415cassava4.1_006972m.381.464cassava4.1_006981m.381.464cassava4.1_006863m.385.468
cassava4.1_007224m.326.407cassava4.1_027486mcassava4.1_017684mcassava4.1_030559mcassava4.1_007073m.366.445
cassava4.1_008277m.291.373cassava4.1_007423m.366.448cassava4.1_004064mcassava4.1_021203mcassava4.1_026286m
cassava4.1_005968m.374.456cassava4.1_032460mcassava4.1_005970m.370.451cassava4.1_006180m.361.443cassava4.1_032359m
cassava4.1_007097m.328.409cassava4.1_006189m.362.443cassava4.1_017504mcassava4.1_016895mcassava4.1_012088m
cassava4.1_006171mcassava4.1_019505m
Medicago truncatulaMedtr5g015720.1.329.412Medtr8g085390.1Medtr8g085440.1Medtr4g132280.1.383.465Medtr5g091650.1
Medtr5g078200.1.361.442Medtr3g083580.1.363.444Medtr5g085580.1.382.465Medtr8g089400.1Medtr3g048280.1
Medtr8g102340.1.334.412Medtr3g065460.1.362.440Medtr8g085720.1.365.446Medtr7g111600.1Medtr5g097420.1
Medtr4g133730.1.28.108Medtr4g133730.1.28.108Medtr4g133730.1.113.196Medtr4g133730.1.113.196Medtr3g082080.1
Medtr4g079530.1AC233675_25.1Medtr2g049670.1Medtr1g116870.1Medtr8g088120.1
Medtr8g085400.1Medtr6g090590.1.334.417
Mimulus guttatusmgv1a024473mmgv1a018942mmgv1a013772mmgv1a018824mmgv1a019800m
mgv1a014620mmgv1a019020mmgv1a011031mmgv1a004953m.369.450mgv1a005776m.382.465
mgv1a005917m.377.460mgv1a005896m.378.460mgv1a006342m.369.446mgv1a016537mmgv1a007544m
mgv1a008915mmgv1a005031m.372.454mgv1a026756mmgv1a005128m.361.442mgv1a004989m.362.443
mgv1a023060mmgv1a014915m
Oryza sativaLOC_Os02g53200.2.400.483LOC_Os02g53200.1.425.508LOC_Os05g50490.2LOC_Os05g50490.1LOC_Os01g53750.1.363.445
LOC_Os07g32600.1.393.474LOC_Os05g50490.3LOC_Os07g32600.2.393.471LOC_Os07g35350.3.377.451LOC_Os07g35350.2.377.457
LOC_Os07g35350.2.377.457LOC_Os07g35350.1.378.458LOC_Os07g35350.1.378.458LOC_Os08g14700.1.381.459LOC_Os08g14700.1.381.459
LOC_Os03g61780.2LOC_Os03g61780.1LOC_Os03g12140.3.332.413LOC_Os03g12140.2.332.413LOC_Os03g12140.1.365.446
LOC_Os07g35350.2.463.544LOC_Os07g35350.2.463.544LOC_Os07g35350.1.464.545LOC_Os07g35350.1.464.545LOC_Os07g35510.1.468.549
LOC_Os07g35510.1.468.549LOC_Os08g14700.1.467.548LOC_Os08g14700.1.467.548LOC_Os07g35560.3.330.410LOC_Os07g35560.3.330.410
LOC_Os07g35560.2.384.464LOC_Os07g35560.2.384.464LOC_Os07g35560.1.428.508LOC_Os07g35560.1.428.508LOC_Os01g44090.1
LOC_Os07g35510.1.382.460LOC_Os07g35510.1.382.460LOC_Os07g38930.5.370.451LOC_Os07g38930.4.370.451LOC_Os07g38930.3.370.451
LOC_Os07g38930.2.370.451LOC_Os07g38930.1.370.451LOC_Os03g25790.2.267.348LOC_Os03g25790.1.267.348LOC_Os06g34660.1
LOC_Os07g35480.3.379.459LOC_Os07g35480.3.379.459LOC_Os07g35480.2.379.459LOC_Os07g35480.2.379.459LOC_Os07g35480.1.379.459
LOC_Os07g35480.1.379.459LOC_Os07g35560.3.416.497LOC_Os07g35560.3.416.497LOC_Os07g35560.2.470.551LOC_Os07g35560.2.470.551
LOC_Os07g35560.1.514.595LOC_Os07g35560.1.514.595LOC_Os07g35520.1.382.462LOC_Os07g35520.1.382.462LOC_Os07g35480.3.465.546
LOC_Os07g35480.3.465.546LOC_Os07g35480.2.465.546LOC_Os07g35480.2.465.546LOC_Os07g35480.1.465.546LOC_Os07g35480.1.465.546
LOC_Os10g20650.2LOC_Os10g20650.1LOC_Os03g54910.1LOC_Os06g45450.1LOC_Os07g40940.1
LOC_Os01g55820.1LOC_Os02g29980.1LOC_Os03g30830.1LOC_Os07g43940.2LOC_Os07g43940.1
LOC_Os05g43690.1LOC_Os07g35520.1.468.549LOC_Os07g35520.1.468.549
Panicum virgatumPavirv00012973mPavirv00021112mPavirv00021949mPavirv00007493mPavirv00031700m
Pavirv00037506mPavirv00042983mPavirv00002396mPavirv00025864mPavirv00002452m.396.478
Pavirv00038260mPavirv00031106mPavirv00016071m.396.474Pavirv00038174mPavirv00058553m.353.435
Pavirv00068281m.392.473Pavirv00014937m.392.473Pavirv00013502m.383.463Pavirv00023750m.365.446Pavirv00064428m.257.339
Pavirv00038624mPavirv00016747mPavirv00011070m.342.423Pavirv00007299m.283.363Pavirv00007299m.283.363
Pavirv00007299m.283.363Pavirv00007299m.207.281Pavirv00007299m.207.281Pavirv00007299m.207.281Pavirv00025441m
Pavirv00047870mPavirv00043118m.359.433Pavirv00007299m.369.450Pavirv00007299m.369.450Pavirv00007299m.369.450
Pavirv00062581m.364.445Pavirv00010764m.364.445Pavirv00010969m.225.306Pavirv00040058m.181.262Pavirv00064003m
Pavirv00052890m.346.427Pavirv00016492mPavirv00055474m.362.442Pavirv00055474m.362.442Pavirv00055474m.448.529
Pavirv00055474m.448.529Pavirv00069751mPavirv00059376m
Physcomitrella patensPp1s51_57V6.2.428.507Pp1s6_62V6.1.412.494Pp1s6_62V6.2.412.490Pp1s138_47V6.2.405.487Pp1s138_47V6.1.405.487
Pp1s98_31V6.1.368.450Pp1s12_287V6.1Pp1s218_3V6.2.412.495Pp1s218_3V6.1.412.495Pp1s85_128V6.1.412.491
Pp1s301_24V6.1Pp1s132_136V6.1Pp1s270_88V6.4.415.498Pp1s270_88V6.3.435.518Pp1s270_88V6.2.435.518
Pp1s270_88V6.1.415.498Pp1s389_50V6.1.308.390Pp1s312_32V6.1.385.463Pp1s325_5V6.1.209.289
Phaseolus vulgarisPhvul.001G222500.1Phvul.006G003800.1Phvul.009G213600.1Phvul.001G268000.1Phvul.003G290700.1
Phvul.006G149100.2.373.454Phvul.006G149100.1.373.454Phvul.002G011900.1.315.397Phvul.001G230000.1.361.442Phvul.008G236700.1.361.442
Phvul.008G213400.1.385.468Phvul.001G056400.1.365.446Phvul.003G079900.1.382.463Phvul.008G231700.1Phvul.011G117000.1
Phvul.006G032800.1Phvul.005G097600.1Phvul.003G290300.1Phvul.002G236300.2.362.443Phvul.002G236300.1.362.443
Phvul.004G077000.1.360.441Phvul.002G245200.2Phvul.002G245200.1Phvul.002G319500.1.363.444Phvul.002G252400.1
Phvul.002G307800.1.366.448Phvul.007G204400.1Phvul.008G271000.1.378.461Phvul.008G285900.1Phvul.003G085200.1
Phvul.005G048800.1
Picea abiesMA_158566g0010MA_8603g0010.396.478MA_41265g0010MA_9241891g0010.422.503MA_5039622g0010
MA_51690g0010.372.454MA_939354g0010MA_962758g0010MA_10436589g0010.415.496MA_10429783g0010.319.400
MA_10213520g0010MA_9796357g0010MA_210389g0010MA_10427115g0010MA_90526g0010.383.465
MA_8718849g0010MA_17470g0010.395.480MA_7353g0010.523.604MA_90526g0020
Populus trichocarpaPotri.013G003500.2Potri.017G055700.1Potri.001G315700.2Potri.001G315700.1Potri.011G006100.1.383.464
Potri.004G010500.2.383.464Potri.004G010500.1.383.464Potri.006G008200.3Potri.006G008200.2Potri.002G224600.3.382.465
Potri.002G224600.2.382.465Potri.002G224600.1.365.448Potri.014G158400.2.382.464Potri.011G094400.2.388.471Potri.011G094400.1.388.471
Potri.002G224600.4.382.460Potri.014G158400.1.382.460Potri.001G353400.2Potri.001G353400.1Potri.001G006500.2.357.439
Potri.001G006500.1.357.439Potri.003G218500.4.357.439Potri.003G218500.2.357.439Potri.003G218500.1.357.439Potri.011G078500.2
Potri.019G012000.1Potri.019G007800.1Potri.011G078500.1Potri.018G068600.1.367.449Potri.014G164600.2
Potri.014G164600.1Potri.007G111000.1Potri.002G059600.1Potri.017G130200.3.347.428Potri.017G130200.2.369.450
Potri.017G130200.1.369.450Potri.006G016800.1Potri.004G086400.3.355.436Potri.004G086400.2.328.409Potri.004G086400.1.369.450
Potri.008G133200.2.328.409Potri.008G133200.1.361.442Potri.010G108500.4.328.409Potri.010G108500.3.328.409Potri.010G108500.2.344.425
Potri.010G108500.1.361.442Potri.005G202400.2Potri.005G202400.1Potri.008G082900.1Potri.010G173500.1
Potri.008G082900.2Potri.016G008900.1Potri.013G003500.1Potri.006G008200.1Potri.019G091500.2
Potri.019G091500.1Potri.013G119500.3Potri.013G119500.2Potri.013G119500.1Potri.005G003500.2
Potri.005G003500.1
Prunus persicappa026075mppa003984m.390.471ppa024163mppa004534m.369.450ppa005210m.384.467
ppa005206m.384.467ppa020432m.349.426ppa1027206m.366.448ppa019395mppa017726m
ppa020813mppa005356m.328.409ppa004732m.362.444ppa002843mppa025080m
ppa026978mppa024492mppa022594mppa010695m
Ricinus communis29724.m00083930125.m00125529904.m00293729842.m003579.388.46929005.m000260.372.453
29661.m000910.335.41530084.m000179.302.38329948.m000713.381.45929693.m00207129932.m000600
29692.m000518.361.44229762.m000502.384.46729826.m00076329597.m00029529912.m005363.367.449
29646.m00110330128.m008973
Setaria italicaSi017666m.262.344Si017035m.401.483Si017686m.262.342Si017685m.262.342Si017681m.262.342
Si023035mSi029448m.389.470Si000583m.536.618Si000582m.536.618Si031358m
Si039775mSi000908m.379.457Si000908m.379.457Si002288mSi001233m.392.469
Si000941m.370.450Si000941m.370.450Si035561m.329.410Si000851m.463.544Si000851m.463.544
Si000851m.377.454Si000851m.377.454Si029628m.364.445Si002346mSi035574m.248.329
Si035572m.248.329Si008520mSi031088mSi031085mSi031083m
Si030973mSi008713mSi036391mSi033221mSi012153m
Si037764mSi031201mSi034773mSi029616m.392.473Si003038m
Si000908m.464.545Si000908m.464.545Si000941m.453.534Si000941m.453.534Si032661m
Selaginella moellendorffii413735.452.53129014442025.353.43576256.333.41028916
75479.348.42896745.356.436402967.358.44059691413731
79527.359.43779013.338.416
Sorghum bicolorSb09g029700.1Sb04g034530.1.403.485Sb03g034100.1.367.449Sb02g032805.1Sb05g002745.1
Sb01g034190.1.223.304Sb02g035520.1.400.480Sb02g035520.1.400.480Sb02g035520.1.400.480Sb02g035480.1.396.477
Sb02g002990.1Sb02g035460.4.384.461Sb02g035460.3.384.461Sb02g035460.2.384.464Sb02g035460.2.384.464
Sb02g035460.1.384.464Sb02g035460.1.384.464Sb01g002540.1Sb02g035490.1.393.473Sb02g035490.1.393.473
Sb01g042560.1.365.446Sb02g035520.1.574.655Sb02g035520.1.574.655Sb02g035520.1.574.655Sb02g037380.1.364.445
Sb02g040340.1Sb03g028790.1Sb10g021130.1Sb02g035460.1.470.549Sb02g035460.1.470.549
Sb02g035460.2.470.551Sb02g035460.2.470.551Sb06g028225.1Sb03g035410.1Sb04g020230.1
Sb01g032330.1Sb02g035490.1.479.560Sb02g035490.1.479.560Sb02g038510.1Sb02g035520.1.488.568
Sb02g035520.1.488.568Sb02g035520.1.488.568Sb09g025330.1
Thellungiella halophilaThhalv10017202mThhalv10019651mThhalv10026599mThhalv10006713m.387.468Thhalv10004376m
Thhalv10018427m.373.454Thhalv10020572m.357.438Thhalv10020571m.357.438Thhalv10020570m.357.438Thhalv10026799m.373.456
Thhalv10004099m.344.425Thhalv10004013m.377.458Thhalv10004286m.344.421Thhalv10008261mThhalv10024870m.394.476
Thhalv10002515m.381.464Thhalv10029156mThhalv10013309m.369.451Thhalv10002820mThhalv10013478m.373.456
Thhalv10005149mThhalv10003112mThhalv10008139mThhalv10006265mThhalv10006312m
Vitis viniferaGSVIVT01021055001GSVIVT01012711001.385.466GSVIVT01036726001GSVIVT01000128001.270.352GSVIVT01030503001.267.350
GSVIVT01031317001GSVIVT01015282001.365.447GSVIVT01037711001.383.466GSVIVT01030060001GSVIVT01021583001
GSVIVT01030716001.360.441GSVIVT01011682001.361.443GSVIVT01025431001.218.299GSVIVT01021386001GSVIVT01020664001
GSVIVT01015894001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)