y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma16g30430.2
FamilyGT90
Protein PropertiesLength: 217 Molecular Weight: 25209.7 Isoelectric Point: 7.0823
ChromosomeChromosome/Scaffold: 16 Start: 34068410 End: 34069518
DescriptionArabidopsis thaliana protein of unknown function (DUF821)
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT9051347.00649e-45
  DWFRELQEGFNKSDLPSQCTYRYKVYIEGSAWSVSQKYILSCDSTTLLVKPKYYDFFTRGLIPVHHHWPIKDDEKCRSIKFAVDWGNNHKQRAHQIGKVA
  SDFIQEEVKMDYVYDYMFHLLNSYAKLFRY
Full Sequence
Protein Sequence     Length: 217     Download
ILFQDWFREL QEGFNKSDLP SQCTYRYKVY IEGSAWSVSQ KYILSCDSTT LLVKPKYYDF    60
FTRGLIPVHH HWPIKDDEKC RSIKFAVDWG NNHKQRAHQI GKVASDFIQE EVKMDYVYDY    120
MFHLLNSYAK LFRYKPSISV NATELCVESM VCGAEGSVKK FMMESLVKVP ANTDPCTMPA    180
PFDPPTLYAT SQRKESSIQQ VESWEKSYWD NQTITS*                             240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam05686Glyco_transf_902.0e-4790205116+
smart00672CAP101.0e-581135140+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN69493.104213168377hypothetical protein [Vitis vinifera]
EMBLCBI22743.10421399308unnamed protein product [Vitis vinifera]
RefSeqXP_002269577.101211165375PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002321919.10521622233predicted protein [Populus trichocarpa]
RefSeqXP_002510788.104212316524KDEL motif-containing protein 1 precursor, putative [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FF54806720642090
EV274975190282170
FF54764519241950
EL42534921312130
FF547645361822170.0000001
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_038_00046.1Aquca_004_00351.1Aquca_045_00089.1
Arabidopsis lyrata910396485256483721887933486604
483723475010
Arabidopsis thalianaAT5G23850.1AT3G48980.1AT3G61290.1AT3G61280.1AT2G45830.2
AT2G45830.1AT2G45840.1AT1G07220.1AT3G61270.1AT1G63420.1
AT3G61280.2
Brachypodium distachyonBradi3g50030.1Bradi5g16810.1Bradi5g16797.1Bradi2g07460.1Bradi1g61560.1
Bradi2g35840.1
Brassica rapaBra018021Bra009709Bra007591Bra007592Bra014445
Bra007593Bra003444Bra007590Bra031558Bra015563
Bra027639Bra004942Bra039310
Carica papayaevm.model.supercontig_18.237evm.model.supercontig_112.24evm.model.supercontig_18.236evm.model.supercontig_107.57
Capsella rubellaCarubv10000648mCarubv10016976mCarubv10019114mCarubv10016988mCarubv10008891m
Carubv10020086mCarubv10018865mCarubv10025566mCarubv10025651m
Chlamydomonas reinhardtiiCre02.g117650.t1.3Cre09.g413500.t1.3Cre12.g531750.t1.2Cre14.g621800.t1.3
Citrus clementinaCiclev10007061mCiclev10023948mCiclev10019760mCiclev10004696mCiclev10019647m
Ciclev10028388mCiclev10020660mCiclev10020252mCiclev10021346mCiclev10020817m
Ciclev10006549m
Citrus sinensisorange1.1g043671morange1.1g044043morange1.1g017178morange1.1g016930morange1.1g011607m
orange1.1g009387morange1.1g011592morange1.1g046815morange1.1g017360morange1.1g022616m
orange1.1g022102morange1.1g022101morange1.1g039857m
Cucumis sativusCucsa.107800.1Cucsa.107750.1Cucsa.135430.1Cucsa.302970.1Cucsa.147060.1
Cucsa.107720.1
Eucalyptus grandisEucgr.A02783.1Eucgr.D01868.1Eucgr.D01866.1Eucgr.E00165.1Eucgr.E00167.1
Eucgr.E00163.1Eucgr.J01883.1Eucgr.D02274.1Eucgr.I01244.1Eucgr.E00171.1
Eucgr.E00168.1Eucgr.E00166.1Eucgr.D01868.3Eucgr.D01868.2.50.190Eucgr.D01868.2.50.190
Eucgr.D01868.2.190.261Eucgr.D01868.2.190.261
Fragaria vescamrna32446.1-v1.0-hybrid.718.966mrna32446.1-v1.0-hybrid.718.966mrna32446.1-v1.0-hybrid.207.452mrna32446.1-v1.0-hybrid.207.452mrna13268.1-v1.0-hybrid.664.916
mrna13268.1-v1.0-hybrid.664.916mrna19062.1-v1.0-hybridmrna07900.1-v1.0-hybridmrna13268.1-v1.0-hybrid.179.419mrna13268.1-v1.0-hybrid.179.419
Glycine maxGlyma16g31231.2Glyma16g31231.1Glyma16g31231.4Glyma16g31231.3Glyma03g01480.2
Glyma09g25490.2Glyma01g42740.2Glyma01g42740.1Glyma07g07910.2Glyma07g08000.2
Glyma03g01490.3Glyma03g01490.2Glyma03g01490.1Glyma18g07010.1Glyma11g27050.2
Glyma11g27050.1Glyma03g01580.2Glyma18g46490.1Glyma09g39700.1Glyma0920s00200.1
Glyma16g30561.1Glyma16g30313.1Glyma16g31241.1
Gossypium raimondiiGorai.004G157700.1Gorai.007G098000.1Gorai.008G277100.1Gorai.007G097900.1Gorai.008G246000.1
Gorai.007G097800.1Gorai.001G116200.1Gorai.008G118500.1.121.260Gorai.008G118500.1.121.260Gorai.008G118500.1.262.331
Gorai.008G118500.1.262.331
Linum usitatissimumLus10039228Lus10040665Lus10018239Lus10039226Lus10024519
Lus10027472Lus10027473Lus10037863.306.434Lus10037863.306.434Lus10008017
Lus10037864.295.404Lus10037864.295.404Lus10037864.182.299Lus10037864.182.299Lus10037863.212.306
Lus10037863.212.306
Malus domesticaMDP0000322698MDP0000322697MDP0000322107MDP0000167387MDP0000158437
MDP0000289383MDP0000239614MDP0000147543MDP0000304021MDP0000246269
MDP0000261453MDP0000151647
Manihot esculentacassava4.1_032880mcassava4.1_028860mcassava4.1_005486mcassava4.1_025567mcassava4.1_027328m
cassava4.1_006037mcassava4.1_007061m.169.306cassava4.1_007061m.169.306cassava4.1_007061m.306.383cassava4.1_007061m.306.383
Medicago truncatulaMedtr6g031170.1Medtr7g076890.1Medtr7g076860.1Medtr5g010500.1Medtr6g031200.1
Medtr6g031190.1
Mimulus guttatusmgv1a020993mmgv1a004518mmgv1a010063m
Oryza sativaLOC_Os02g42920.1LOC_Os04g45160.1LOC_Os04g45140.1LOC_Os05g05690.1LOC_Os08g01150.1
LOC_Os04g45160.2LOC_Os06g05940.1
Panicum virgatumPavirv00027487mPavirv00066339mPavirv00043004mPavirv00000938mPavirv00017588m
Pavirv00066593mPavirv00063931mPavirv00046116mPavirv00058150mPavirv00052814m
Pavirv00002686mPavirv00035277mPavirv00024822mPavirv00027719mPavirv00069435m
Pavirv00064656mPavirv00033981mPavirv00004308mPavirv00021245m.180.302Pavirv00021245m.180.302
Pavirv00063538mPavirv00021245m.77.169Pavirv00021245m.77.169
Phaseolus vulgarisPhvul.004G116000.1Phvul.010G096100.1Phvul.010G096500.1Phvul.006G068300.1
Picea abiesMA_53054g0010MA_32961g0010MA_116478g0010MA_55748g0010MA_10425862g0010
MA_689724g0010MA_129161g0010MA_10435424g0020MA_23554g0010MA_912717g0010
MA_9597898g0010MA_4631294g0010
Populus trichocarpaPotri.015G144400.2Potri.015G144400.1Potri.003G125000.3Potri.003G125000.2Potri.003G125000.1
Potri.014G081600.1Potri.001G252000.1Potri.002G157800.2Potri.002G157800.1Potri.002G157900.1
Prunus persicappa023179mppa005169mppa004159mppa014578mppa024728m
ppa019065mppa008339mppa026562m
Ricinus communis30147.m01373930147.m01374030174.m00900430174.m00900529681.m001352
30190.m011190
Setaria italicaSi035011mSi016818mSi009846mSi009843mSi024592m
Si012640mSi006188mSi025803mSi013493mSi039647m
Si008749m
Selaginella moellendorffii10148312256141909153405442089
6285062763910456480381791
6314353728
Sorghum bicolorSb06g023680.1Sb04g033620.1Sb06g023670.1Sb09g003810.1Sb10g003730.1
Sb07g000280.1
Thellungiella halophilaThhalv10003948mThhalv10010269mThhalv10005889mThhalv10023375mThhalv10006441m
Thhalv10001309m.50.298Thhalv10001309m.50.298Thhalv10001309m.501.754Thhalv10001309m.501.754Thhalv10007804m
Vitis viniferaGSVIVT01028972001GSVIVT01026877001.101.348GSVIVT01026877001.101.348GSVIVT01019779001GSVIVT01026877001.483.731
GSVIVT01026877001.483.731GSVIVT01026872001GSVIVT01024736001GSVIVT01026876001GSVIVT01026878001
GSVIVT01026871001.50.297GSVIVT01026871001.50.297GSVIVT01026871001.50.297GSVIVT01026873001GSVIVT01028968001
GSVIVT01026871001.476.608GSVIVT01026871001.476.608GSVIVT01026871001.476.608GSVIVT01026871001.628.756GSVIVT01026871001.628.756
GSVIVT01026871001.628.756GSVIVT01026874001
Volvox carteriVocar20006148mVocar20001995m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)