y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma16g33881.1
FamilyGT66
Protein PropertiesLength: 734 Molecular Weight: 82363.9 Isoelectric Point: 9.3712
ChromosomeChromosome/Scaffold: 16 Start: 36635980 End: 36642060
Descriptionstaurosporin and temperature sensitive 3-like b
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT66386830
  LIRVATLSLIYVLAFITRLFSVLRYESMIHEFDPYFNYRTTLFLTRNGFAEFWNWFDSESWYPLGRIIGGTLYPGLMLTAAAIHSLLRFLRLFVHIREVC
  VLTAPFFASNTTLVAYFFAKEVWDSGAGIVAAALIAICPGYISRSVAGSYDNEGVAIFALLLTFYLFVKAVNTGSLAWALGSAFGYFYMVSAWGGYVFII
  NLVPLYVLVLLVTGRYSLRLYVAYNCMYVLGMLLAMQIRFVGFQHVQSGEHMAAMGVFFLLQVFFFLDWVRHLLSDTKLFQAFLRITVTSAVAVGAVALG
  VGTASGYISPWTGRFYSLLDPTYAKDHIPIIASVSEHQPTAWSSFMFDFHILLFLFPAGLYFCFKRLSDATIFLVMYGLTSMYFAGVMVRLILVATPAVC
  LISAIAVSATVKNLARVVRAKSPAVQSGSTKGTNSAKSSSKGVVDNSQPFQKNGAIVLLLGAFYLLSRYVIHCTWVTSEAYSSPSIVLAARGAHGNRVIF
  DDYREAYFWLRQNTPPDAKVMSWWDYGYQITAMGNRTVIVDNNTWNNTHIATVGRAMSSYEDEAYEIMRSLDVDYVLVVFGGVTGYSSDDINKFLWMVRI
  GGGVFPVIKEPDYLVNGEYRVDKGAAPKMLNCLMYKLSYYRFGELT
Full Sequence
Protein Sequence     Length: 734     Download
MVVTTTKSSP MAQDLKTSMS SFTLPKTLKL KTKQQELLIR VATLSLIYVL AFITRLFSVL    60
RYESMIHEFD PYFNYRTTLF LTRNGFAEFW NWFDSESWYP LGRIIGGTLY PGLMLTAAAI    120
HSLLRFLRLF VHIREVCVLT APFFASNTTL VAYFFAKEVW DSGAGIVAAA LIAICPGYIS    180
RSVAGSYDNE GVAIFALLLT FYLFVKAVNT GSLAWALGSA FGYFYMVSAW GGYVFIINLV    240
PLYVLVLLVT GRYSLRLYVA YNCMYVLGML LAMQIRFVGF QHVQSGEHMA AMGVFFLLQV    300
FFFLDWVRHL LSDTKLFQAF LRITVTSAVA VGAVALGVGT ASGYISPWTG RFYSLLDPTY    360
AKDHIPIIAS VSEHQPTAWS SFMFDFHILL FLFPAGLYFC FKRLSDATIF LVMYGLTSMY    420
FAGVMVRLIL VATPAVCLIS AIAVSATVKN LARVVRAKSP AVQSGSTKGT NSAKSSSKGV    480
VDNSQPFQKN GAIVLLLGAF YLLSRYVIHC TWVTSEAYSS PSIVLAARGA HGNRVIFDDY    540
REAYFWLRQN TPPDAKVMSW WDYGYQITAM GNRTVIVDNN TWNNTHIATV GRAMSSYEDE    600
AYEIMRSLDV DYVLVVFGGV TGYSSDDINK FLWMVRIGGG VFPVIKEPDY LVNGEYRVDK    660
GAAPKMLNCL MYKLSYYRFG ELTTEYGKPP GYDRARGVEI GNKDIKLEYL EEAFTTQNWI    720
VRIYKVKPPK NRW*                                                      780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR04154archaeo_STT34.0e-8366615284+
TIGR04154archaeo_STT37.0e-1144237218+
COG1287COG12878.0e-6039731730+
pfam02516STT31.0e-13339684666+
Gene Ontology
GO TermDescription
GO:0004576oligosaccharyl transferase activity
GO:0006486protein glycosylation
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001131374.10177324719hypothetical protein LOC100192699 [Zea mays]
RefSeqNP_174675.2077329734STT3B (staurosporin and temperature sensitive 3-like b); oligosaccharyl transferase [Arabidopsis thaliana]
RefSeqXP_002269119.101773317737PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002318345.103473322721predicted protein [Populus trichocarpa]
RefSeqXP_002329687.101973325721predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2lgz_A050972720238A Chain A, Solution Structure Of Stt3p
PDB3vu0_C0.0000035396556123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_B0.0000035396556123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vu0_A0.0000035396556123A Chain A, Crystal Structure Of The C-terminal Globular Domain Of Oligosaccharyltransferase (afaglb-s2, Af_0040, O30195_arcfu) From Archaeoglobus Fulgidus
PDB3vgp_A0.000045386396113A Chain A, Crystal Structure Of The C-Terminal Globular Domain Of Oligosaccharyltransferase (Af_0329) From Archaeoglobus Fulgidus
Transmembrane Domains
StartEnd
3759
102124
131153
163185
192214
229251
258280
290312
319341
379401
408430
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8701293234107320
GO8695183263837080
GT0360633473086540
GO869518196997170.98
GO869518157107240.98
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_01458.1Aquca_001_00320.1
Arabidopsis lyrata891007488863
Arabidopsis thalianaAT1G34130.1AT5G19690.1
Brachypodium distachyonBradi5g26030.1Bradi2g49640.1Bradi2g19510.1
Brassica rapaBra028034Bra006514Bra002255Bra034441
Carica papayaevm.model.supercontig_467.1.248.439evm.model.supercontig_467.1.248.439evm.model.supercontig_40.47
Capsella rubellaCarubv10008402mCarubv10000271m
Chlamydomonas reinhardtiiCre07.g330100.t1.2g9581.t1
Citrus clementinaCiclev10019005mCiclev10019106mCiclev10007574mCiclev10007513mCiclev10007684m
Citrus sinensisorange1.1g004635morange1.1g005395morange1.1g004678morange1.1g003973m
Cucumis sativusCucsa.122250.1Cucsa.122250.2Cucsa.329260.1Cucsa.329260.2
Eucalyptus grandisEucgr.K02314.1Eucgr.C01008.1
Fragaria vescamrna09173.1-v1.0-hybridmrna11885.1-v1.0-hybrid
Glycine maxGlyma09g29470.1Glyma01g01270.1Glyma16g08410.1
Gossypium raimondiiGorai.013G004300.1Gorai.013G004300.2Gorai.011G219600.1Gorai.011G219600.4Gorai.011G219600.3
Gorai.011G219600.2Gorai.011G219600.5Gorai.013G229700.1Gorai.010G075800.1Gorai.010G075800.2
Gorai.010G075800.3
Linum usitatissimumLus10041985Lus10017990Lus10043241Lus10011124
Malus domesticaMDP0000299027MDP0000589608MDP0000158858MDP0000201702MDP0000300736
Manihot esculentacassava4.1_002347mcassava4.1_021540m
Medicago truncatulaMedtr6g077750.1Medtr6g077750.2Medtr1g114250.1
Mimulus guttatusmgv1a001976mmgv1a001650m
Oryza sativaLOC_Os04g57890.1LOC_Os05g44360.1LOC_Os05g44360.2
Panicum virgatumPavirv00017930mPavirv00007453mPavirv00022940mPavirv00024588mPavirv00056880m
Pavirv00065583m
Physcomitrella patensPp1s98_21V6.1Pp1s404_37V6.1Pp1s404_38V6.1
Phaseolus vulgarisPhvul.004G139400.1Phvul.004G170000.1
Picea abiesMA_174842g0010MA_10216317g0010MA_5501292g0010MA_10436134g0010
Populus trichocarpaPotri.012G036300.1Potri.015G028300.1Potri.015G028300.2Potri.018G086000.2Potri.018G086000.1
Potri.006G163600.1
Prunus persicappa001886mppa001464m
Ricinus communis30189.m00167429912.m005461
Setaria italicaSi021341mSi000402mSi021271mSi021321m
Selaginella moellendorffii110405118919
Sorghum bicolorSb06g032800.1Sb09g025920.1Sb03g034385.1
Thellungiella halophilaThhalv10006908mThhalv10012742m
Vitis viniferaGSVIVT01015322001GSVIVT01029339001
Volvox carteriVocar20013212mVocar20003562m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)