y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma17g01880.1
FamilyGH1
Protein PropertiesLength: 186 Molecular Weight: 21523.5 Isoelectric Point: 7.9589
ChromosomeChromosome/Scaffold: 17 Start: 1163421 End: 1164440
Descriptionbeta-glucosidase 47
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH111860
  GDRVKYWATFNEPNFLVPLGYRSAMAKCSEGDSEKEPFIAAHNVILSHAAAVDIHRTKCQYRYSLQHEWFEPMSNSTADKLATERARAFSFNWFLDPIIF
  GKYPTEMENVLGSLLPKFSSHEKEKLKKGLDFIGLNYYTAFMSKIACTPRTPFSWFNIYIYPDGMEKAVTCVRDRYNNTPIFITEN
Full Sequence
Protein Sequence     Length: 186     Download
GDRVKYWATF NEPNFLVPLG YRSAMAKCSE GDSEKEPFIA AHNVILSHAA AVDIHRTKCQ    60
YRYSLQHEWF EPMSNSTADK LATERARAFS FNWFLDPIIF GKYPTEMENV LGSLLPKFSS    120
HEKEKLKKGL DFIGLNYYTA FMSKIACTPR TPFSWFNIYI YPDGMEKAVT CVRDRYNNTP    180
IFITEN                                                               240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG2723BglB2.0e-331186213+
PLN02814PLN028143.0e-341186222+
PLN02849PLN028494.0e-351186220+
TIGR03356BGL1.0e-361186203+
pfam00232Glyco_hydro_12.0e-391186211+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN68643.101186114341hypothetical protein [Vitis vinifera]
EMBLCBI23186.101186200427unnamed protein product [Vitis vinifera]
RefSeqXP_002264678.10118690317PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002305597.101186189416predicted protein [Populus trichocarpa]
RefSeqXP_002335958.10118615242predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3gnr_A9.99967e-421186167395A Chain A, The Structure Of A Protein In Glycosyl Transferase Family 8 From Anaerococcus Prevotii.
PDB3gnp_A9.99967e-421186167395A Chain A, The Structure Of A Protein In Glycosyl Transferase Family 8 From Anaerococcus Prevotii.
PDB3gno_A9.99967e-421186167395A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB2rgm_B4e-391186170392A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
PDB2rgm_A4e-391186170392A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase
Metabolic Pathways
Pathway NameReactionECProtein Name
coumarin biosynthesis (via 2-coumarate)RXN-8036EC-3.2.1.21β-glucosidase
linamarin degradationRXN-5341EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-13602EC-3.2.1.21β-glucosidase
linustatin bioactivationRXN-5341EC-3.2.1.21β-glucosidase
lotaustralin degradationRXN-9674EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-13603EC-3.2.1.21β-glucosidase
neolinustatin bioactivationRXN-9674EC-3.2.1.21β-glucosidase
taxiphyllin bioactivationRXN-13600EC-3.2.1.21β-glucosidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
AW234927190261810
BG362816177441860
HO78581915911410
CX63522622811860
CX705543174471860