y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma17g07500.2
FamilyGH33
Protein PropertiesLength: 293 Molecular Weight: 32662.5 Isoelectric Point: 8.9332
ChromosomeChromosome/Scaffold: 17 Start: 5496692 End: 5501330
DescriptionBNR/Asp-box repeat family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH33482727.9e-24
  FTYQAGSAPFKSCHASTIVEVDKDHFLVAYFGGTFEGAPDVKIWVQTYKNGRWQAPVIADEEPNVPMWNPALFKLPSDELLLFYKIGQEVQKWSGFMKRS
  YDKGKTWTGREQLPPGILGPIKNKPILLENGNLLCGSSVESWNSWGAWVEVTTDFGRSWSKYGPIYIENKPLSVIQPVPYQTADGKLRVLLRSFDGIGRV
  CMSESSDGGKTWGYAKPTQLPNPNS
Full Sequence
Protein Sequence     Length: 293     Download
MGQALSRIHR MIVSSSVKEK KKNTAISRVQ PLAMASNCSI EGPLVEEFTY QAGSAPFKSC    60
HASTIVEVDK DHFLVAYFGG TFEGAPDVKI WVQTYKNGRW QAPVIADEEP NVPMWNPALF    120
KLPSDELLLF YKIGQEVQKW SGFMKRSYDK GKTWTGREQL PPGILGPIKN KPILLENGNL    180
LCGSSVESWN SWGAWVEVTT DFGRSWSKYG PIYIENKPLS VIQPVPYQTA DGKLRVLLRS    240
FDGIGRVCMS ESSDGGKTWG YAKPTQLPNP NSGQFCKHII ACKFLLNNYD IF*           300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13088BNR_22.0e-5113259150+
COG4692COG46925.0e-2156272234+
pfam13088BNR_25.0e-7071274216+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU18568.1012731273unknown [Glycine max]
RefSeqNP_851204.104427314243BNR/Asp-box repeat family protein [Arabidopsis thaliana]
RefSeqXP_002263578.104027355288PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002324495.10342731240predicted protein [Populus trichocarpa]
RefSeqXP_002531744.10342731240conserved hypothetical protein [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FG98901724412440
FG812628240342730
BW685814253202720
EE258658239342720
EY114510231432730
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_027_00263.5Aquca_027_00263.1Aquca_027_00263.2Aquca_027_00263.3Aquca_027_00263.4
Arabidopsis lyrata495867
Arabidopsis thalianaAT5G57700.1AT5G57700.2AT5G57700.3AT5G57700.4
Brachypodium distachyonBradi1g26287.2Bradi1g26287.4Bradi1g26287.1Bradi1g26287.3
Brassica rapaBra006806
Capsella rubellaCarubv10028058m
Citrus clementinaCiclev10008429m
Citrus sinensisorange1.1g020796m
Cucumis sativusCucsa.063760.7Cucsa.063760.5Cucsa.063760.1
Eucalyptus grandisEucgr.C02440.3Eucgr.C02440.2Eucgr.C02440.1
Fragaria vescamrna29636.1-v1.0-hybrid
Glycine maxGlyma13g01390.2Glyma13g01380.1Glyma17g07500.3Glyma17g07500.1
Gossypium raimondiiGorai.010G053100.8Gorai.010G053100.9Gorai.010G053100.6Gorai.012G095700.1Gorai.010G053100.5
Gorai.010G053100.4Gorai.010G053100.3Gorai.010G053100.2Gorai.010G053100.10Gorai.010G053100.1
Linum usitatissimumLus10008903
Malus domesticaMDP0000155009
Manihot esculentacassava4.1_011952m
Medicago truncatulaMedtr4g129200.1Medtr4g129180.1
Mimulus guttatusmgv1a018339m
Oryza sativaLOC_Os07g33220.1LOC_Os07g33224.1
Panicum virgatumPavirv00000088mPavirv00019697mPavirv00063023mPavirv00001202mPavirv00001203m
Pavirv00068158mPavirv00059537m
Physcomitrella patensPp1s96_140V6.2
Phaseolus vulgarisPhvul.003G150200.1Phvul.003G150000.2Phvul.003G150000.1Phvul.003G150000.4Phvul.003G150000.5
Phvul.003G150000.3Phvul.003G150000.6
Picea abiesMA_10435121g0010
Populus trichocarpaPotri.018G097100.1
Prunus persicappa020159m
Ricinus communis29749.m000140
Setaria italicaSi030500mSi030939mSi030026mSi029094m
Selaginella moellendorffii84263
Sorghum bicolorSb02g034675.1Sb02g034680.1
Thellungiella halophilaThhalv10013983m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny