y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma17g31721.1
FamilyGH28
Protein PropertiesLength: 258 Molecular Weight: 28119 Isoelectric Point: 8.6406
ChromosomeChromosome/Scaffold: 17 Start: 34928651 End: 34931843
DescriptionPectin lyase-like superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH28532480
  CGASNGTSTLVVPAGHTFFVRQTRFRGPCQSQKLDIQIMGNLLAPTKDAWKKCSGPWLYFLDVRGMTVHGSGVINGQGRDWWGKPYGTGACSHMPTALLF
  QRCDGLQISGLTHINGPGSHIFVVHSQDITISNIDIYSPLESHNTDGIDLTNSVRVNIRDSIIRTGDDCIAMKGGSKFININNVTCGPGHGIRYSS
Full Sequence
Protein Sequence     Length: 258     Download
MDLFKIGILI FSTVSCNLWV GHGQRFDVLN YGAKGNGRSD DTNAFVQAWK ALCGASNGTS    60
TLVVPAGHTF FVRQTRFRGP CQSQKLDIQI MGNLLAPTKD AWKKCSGPWL YFLDVRGMTV    120
HGSGVINGQG RDWWGKPYGT GACSHMPTAL LFQRCDGLQI SGLTHINGPG SHIFVVHSQD    180
ITISNIDIYS PLESHNTDGI DLTNSVRVNI RDSIIRTGDD CIAMKGGSKF ININNVTCGP    240
GHGIRYSSKC ELYKYSQ*                                                  300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02188PLN021882.0e-4526248227+
PLN02218PLN022188.0e-5628248226+
PLN03003PLN030034.0e-6226248223+
PLN02793PLN027935.0e-6426248228+
PLN03010PLN030102.0e-6422248229+
Gene Ontology
GO TermDescription
GO:0004650polygalacturonase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAY21049.1032484256PGN [Glycine max]
GenBankABC75354.102624823244Glycoside hydrolase, family 28 [Medicago truncatula]
RefSeqNP_195292.202224820245glycoside hydrolase family 28 protein / polygalacturonase (pectinase) family protein [Arabidopsis thaliana]
RefSeqXP_002324855.1092489249predicted protein [Populus trichocarpa]
RefSeqXP_002515526.1012481246Polygalacturonase-2 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3jur_D0.00000000042422726268A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB3jur_C0.00000000042422726268A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB3jur_B0.00000000042422726268A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB3jur_A0.00000000042422726268A Chain A, The Crystal Structure Of A Hyperthermoactive Exopolygalacturonase From Thermotoga Maritima
PDB1nhc_F0.0000000016024824203A Chain A, Structural Insights Into The Processivity Of Endopolygalacturonase I From Aspergillus Niger
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2103EC-3.2.1.15polygalacturonase
Signal Peptide
Cleavage Site
23
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BI31114824712440
CX539150203402400
DY961682231262480
DY964976227262440
EH673898224262410
Orthologous Group
SpeciesID
Brassica rapaBra040077
Citrus sinensisorange1.1g047411m
Fragaria vescamrna30795.1-v1.0-hybrid
Glycine maxGlyma08g25901.1
Gossypium raimondiiGorai.011G082300.1
Malus domesticaMDP0000600336MDP0000146841
Prunus persicappa021254m.37.202ppa021254m.37.202
Vitis viniferaGSVIVT01017354001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny