y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma17g33730.2
FamilyAA2
Protein PropertiesLength: 331 Molecular Weight: 35804.6 Isoelectric Point: 4.6016
ChromosomeChromosome/Scaffold: 17 Start: 37688974 End: 37692078
DescriptionPeroxidase superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2563130
  SSSDPSIPGKLLRLVFHDCFVEGCDASLMLLGNNTEKSDPANRSVGGFSVIESAKRVLEFLCPGTVSCADIIALAARDAVEIVGGPMIEIPTGRRDGMVS
  VASNVRPNILDTSFTMDEMINRFSSKGLSLFDLVILSGAHTIGAAHCSSFRDRFQEDSKGKLTLIDKTLDNTYADELMKECPLSASPSVTVNNDPETSMV
  FDNQYYRNLLTNKGLFQSDSALLSDNRTRKFVEDLANDQEFFFESWGQSFLKLTSIGV
Full Sequence
Protein Sequence     Length: 331     Download
MEKGAMVFPF PIAVSCLFII VHIFANSVSG SLVFNFYAAS CPTAELIVRN TVSSSSSSDP    60
SIPGKLLRLV FHDCFVEGCD ASLMLLGNNT EKSDPANRSV GGFSVIESAK RVLEFLCPGT    120
VSCADIIALA ARDAVEIVGG PMIEIPTGRR DGMVSVASNV RPNILDTSFT MDEMINRFSS    180
KGLSLFDLVI LSGAHTIGAA HCSSFRDRFQ EDSKGKLTLI DKTLDNTYAD ELMKECPLSA    240
SPSVTVNNDP ETSMVFDNQY YRNLLTNKGL FQSDSALLSD NRTRKFVEDL ANDQEFFFES    300
WGQSFLKLTS IGVKTGDEGE IRSSCASINA *                                   360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00141peroxidase4.0e-626229332+
cd00314plant_peroxidase_like5.0e-2348310299+
pfam00141peroxidase2.0e-5648197151+
PLN03030PLN030303.0e-7736329301+
cd00693secretory_peroxidase4.0e-14832328300+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACJ11760.101732918332class III peroxidase [Gossypium hirsutum]
RefSeqNP_194904.102932926326peroxidase, putative [Arabidopsis thaliana]
RefSeqXP_002285587.1013301329PREDICTED: hypothetical protein isoform 1 [Vitis vinifera]
RefSeqXP_002309694.101833020332predicted protein [Populus trichocarpa]
RefSeqXP_002324930.1093265330predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3hdl_A0323302304A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB1qo4_A0363307305A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB1pa2_A0363307305A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB1qgj_B0353295299A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1qgj_A0353295299A Chain A, Arabidopsis Thaliana Peroxidase N
Metabolic Pathways
Pathway NameReactionECProtein Name
betanidin degradationRXN-8635EC-1.11.1.7peroxidase
Transmembrane Domains
StartEnd
729
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CV52973426912690
CV245011261713310
EV27596222012200
FQ462171254322850
CV529734242672900.008
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_016_00365.1
Arabidopsis lyrata328551481340
Arabidopsis thalianaAT4G31760.1AT2G24800.1
Brachypodium distachyonBradi5g14650.1
Brassica rapaBra007831
Capsella rubellaCarubv10006533mCarubv10025481m
Citrus clementinaCiclev10008792m
Citrus sinensisorange1.1g019972m
Cucumis sativusCucsa.271330.1
Eucalyptus grandisEucgr.C04029.1
Fragaria vescamrna14987.1-v1.0-hybrid
Glycine maxGlyma14g12170.1Glyma06g06350.1
Gossypium raimondiiGorai.001G039200.1Gorai.009G064700.2Gorai.009G064700.1Gorai.001G039200.2
Linum usitatissimumLus10026903Lus10020097
Malus domesticaMDP0000289293
Manihot esculentacassava4.1_011556m
Medicago truncatulaMedtr3g105790.1
Mimulus guttatusmgv1a021862m
Panicum virgatumPavirv00013823mPavirv00002787m
Phaseolus vulgarisPhvul.009G085800.1Phvul.001G043100.2Phvul.001G043100.1
Populus trichocarpaPotri.018G015500.1Potri.006G267400.1
Prunus persicappa025451m
Ricinus communis29848.m004502
Setaria italicaSi011734m
Selaginella moellendorffii106106
Sorghum bicolorSb06g021550.1
Thellungiella halophilaThhalv10025685mThhalv10000495m
Vitis viniferaGSVIVT01036009001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny