y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma18g00630.3
FamilyGH16
Protein PropertiesLength: 206 Molecular Weight: 23873.8 Isoelectric Point: 9.3956
ChromosomeChromosome/Scaffold: 18 Start: 266878 End: 268791
Descriptionxyloglucan endotransglucosylase/hydrolase 16
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1681336.2e-22
  GNSAGTVTAYYLSSQGPTHDEIDFEFLGNVSGDPYILHTNVFTKGQGNREQQFYLWFDPTRNFHTYSIIWKPQHIIFLVDNIPIRVFKNAETIGVPFPKN
  QPMRIYSSLWNADDWATRGGLVKTDW
Full Sequence
Protein Sequence     Length: 206     Download
MQLKLVAGNS AGTVTAYYLS SQGPTHDEID FEFLGNVSGD PYILHTNVFT KGQGNREQQF    60
YLWFDPTRNF HTYSIIWKPQ HIIFLVDNIP IRVFKNAETI GVPFPKNQPM RIYSSLWNAD    120
DWATRGGLVK TDWSKAPFTA YYRNFKATEF STSSSNSFSD AAWQSNELDA YGRRRLRWAQ    180
KYFMIYNYCN DLKRFPQGIP AECRR*                                         240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00413Glyco_hydrolase_169.0e-199127127+
cd02183GH16_fungal_CRH1_transglycosylase7.0e-284148158+
pfam00722Glyco_hydro_161.0e-611135137+
PLN03161PLN031613.0e-881203213+
cd02176GH16_XET7.0e-1221203212+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005618cell wall
GO:0005975carbohydrate metabolic process
GO:0006073cellular glucan metabolic process
GO:0016762xyloglucan:xyloglucosyl transferase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACJ84668.10120378281unknown [Medicago truncatula]
GenBankACU14124.10120075274unknown [Glycine max]
GenBankACU23820.10120579283unknown [Glycine max]
GenBankACU24073.10120575276unknown [Glycine max]
Swiss-ProtP356940120579283BRU1_SOYBN RecName: Full=Brassinosteroid-regulated protein BRU1; Flags: Precursor
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1un1_B0120564274A Chain A, Crystal Structures Of Soybean Beta-Amylase Reacted With Beta-Maltose And Maltal: Active Site Components And Their Apparent Role In Catalysis
PDB1un1_A0120564274A Chain A, Crystal Structures Of Soybean Beta-Amylase Reacted With Beta-Maltose And Maltal: Active Site Components And Their Apparent Role In Catalysis
PDB1umz_B0120564274A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg.
PDB1umz_A0120564274A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg.
PDB2uwb_B0319467259A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EV26721220012000
FG86110720612060
FG91556020612060
CA92059420512050
GW88470920612060
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_067_00021.1Aquca_133_00020.1Aquca_024_00022.4Aquca_024_00022.3Aquca_024_00022.2
Aquca_024_00021.2Aquca_024_00021.1Aquca_016_00256.1Aquca_003_00770.1Aquca_024_00022.1
Aquca_005_00378.2Aquca_005_00378.1Aquca_022_00058.1Aquca_037_00308.1Aquca_068_00057.1
Aquca_043_00081.1Aquca_068_00058.1Aquca_024_00021.3Aquca_004_00167.1Aquca_016_00256.2
Aquca_002_01199.1Aquca_133_00018.1Aquca_043_00083.1Aquca_001_00359.1Aquca_012_00139.1
Aquca_127_00003.2Aquca_127_00003.1Aquca_001_00358.1
Arabidopsis lyrata490836480350488211496809480225
490240479888493497343582913451
495852354208918931495853329091
494858475629491722491721471290
858417491872475586
Arabidopsis thalianaAT4G37800.1AT5G13870.1AT5G65730.1AT2G06850.1AT4G03210.1
AT4G14130.1AT3G23730.1AT5G57530.1AT4G03210.2AT5G57540.1
AT2G18800.1AT4G30270.1AT5G57560.1AT5G57550.1AT4G25810.1
AT2G14620.1AT4G25820.1AT5G48070.1AT1G65310.1AT4G30280.1
AT4G30290.1AT1G11545.1AT4G28850.1
Brachypodium distachyonBradi4g16990.1Bradi1g33810.1Bradi1g33840.1Bradi1g33817.1Bradi5g20726.1
Bradi5g22907.1Bradi1g33827.1Bradi3g18690.1Bradi1g25847.1Bradi3g31767.1
Bradi3g10290.1Bradi3g10310.1Bradi5g20734.1Bradi5g20742.1Bradi3g18607.1
Brassica rapaBra034193Bra017855Bra006220Bra024415Bra008796
Bra000840Bra013164Bra038442Bra014975Bra011179
Bra002723Bra024089Bra020436Bra002719Bra013922
Bra008806Bra002722Bra040716Bra020434Bra020432
Bra020433Bra019141Bra013923Bra002720Bra002718
Bra010292Bra038819Bra024087Bra024088Bra010291
Bra011181Bra011180Bra010290Bra019846Bra011066
Carica papayaevm.model.supercontig_233.23evm.model.supercontig_70.34evm.model.supercontig_38.50evm.model.supercontig_129.52evm.model.supercontig_157.21
evm.model.supercontig_233.25evm.model.supercontig_233.22evm.model.supercontig_34.46evm.model.supercontig_95.62evm.model.supercontig_233.26
evm.model.supercontig_233.21evm.TU.contig_27001.5evm.model.supercontig_233.24evm.model.supercontig_198.12
Capsella rubellaCarubv10005387mCarubv10001606mCarubv10001605mCarubv10026888mCarubv10014286m
Carubv10001618mCarubv10005405mCarubv10014298mCarubv10027984mCarubv10027622m
Carubv10015626mCarubv10014279mCarubv10005183mCarubv10026914mCarubv10026912m
Carubv10005412mCarubv10028369mCarubv10009849mCarubv10006309mCarubv10027651m
Carubv10007207mCarubv10005373mCarubv10005455mCarubv10006385m
Citrus clementinaCiclev10029863mCiclev10016123mCiclev10028958mCiclev10028851mCiclev10005561m
Ciclev10016129mCiclev10026210mCiclev10010858mCiclev10008951mCiclev10008778m
Ciclev10009119mCiclev10009118mCiclev10009172mCiclev10010760mCiclev10010798m
Ciclev10010722mCiclev10010412mCiclev10010151mCiclev10010330mCiclev10010859m
Ciclev10013733mCiclev10013680mCiclev10015776mCiclev10010531m
Citrus sinensisorange1.1g022638morange1.1g022696morange1.1g020962morange1.1g022821morange1.1g023112m
orange1.1g023581morange1.1g023204morange1.1g023431morange1.1g023337morange1.1g039255m
orange1.1g022933morange1.1g045763morange1.1g047166morange1.1g036092morange1.1g036067m
orange1.1g040673morange1.1g045443morange1.1g028152morange1.1g038982morange1.1g022405m
orange1.1g028253m
Cucumis sativusCucsa.002250.1Cucsa.148190.1Cucsa.092360.1Cucsa.092370.1Cucsa.092340.1
Cucsa.092330.1Cucsa.089740.1Cucsa.172970.1Cucsa.089730.1Cucsa.092350.1
Cucsa.298590.1Cucsa.185390.1Cucsa.185400.1Cucsa.185410.1Cucsa.092380.1
Cucsa.326860.1Cucsa.086060.1Cucsa.326890.1Cucsa.340750.1
Eucalyptus grandisEucgr.I00659.1Eucgr.G01909.1Eucgr.J01663.1Eucgr.C00176.1Eucgr.K00883.1
Eucgr.C00179.1Eucgr.C00178.1Eucgr.C00184.1Eucgr.C00181.1Eucgr.C00180.2
Eucgr.C00180.1Eucgr.H02634.1Eucgr.C03800.1Eucgr.C02203.1Eucgr.A01968.1
Eucgr.H00623.1Eucgr.H00619.1Eucgr.B01596.1Eucgr.G01182.1Eucgr.G01174.1
Eucgr.L03394.1Eucgr.C00175.1Eucgr.D01294.1Eucgr.A01966.1Eucgr.A01967.1
Fragaria vescamrna05591.1-v1.0-hybridmrna00216.1-v1.0-hybridmrna05204.1-v1.0-hybridmrna01986.1-v1.0-hybridmrna12291.1-v1.0-hybrid
mrna28696.1-v1.0-hybrid.108.274mrna28696.1-v1.0-hybrid.108.274mrna24871.1-v1.0-hybridmrna19782.1-v1.0-hybridmrna19781.1-v1.0-hybrid
mrna19783.1-v1.0-hybridmrna06605.1-v1.0-hybridmrna28697.1-v1.0-hybridmrna28696.1-v1.0-hybrid.400.563mrna28696.1-v1.0-hybrid.400.563
mrna28698.1-v1.0-hybridmrna19553.1-v1.0-hybridmrna28699.1-v1.0-hybridmrna09279.1-v1.0-hybrid
Glycine maxGlyma17g16890.2Glyma05g23170.1Glyma01g40460.1Glyma02g07610.1Glyma16g04950.1
Glyma19g28220.1Glyma11g04820.1Glyma16g04960.1Glyma06g45860.2Glyma12g10960.1
Glyma13g00280.1Glyma17g07250.1Glyma13g01120.1Glyma13g38040.1Glyma17g07220.1
Glyma12g32390.1Glyma13g01140.1Glyma17g07270.1Glyma17g07260.1Glyma17g07240.1
Glyma17g07280.1Glyma13g01150.1Glyma13g01110.1Glyma15g18360.1Glyma09g07070.1
Glyma02g45670.1Glyma20g27380.1Glyma14g03140.1Glyma10g40040.1Glyma18g12690.1
Glyma09g32630.1Glyma01g34770.1Glyma08g04020.1Glyma08g12800.1Glyma05g29690.1
Glyma10g39760.1Glyma05g28310.2Glyma08g11300.2Glyma11g36730.2Glyma20g27970.1
Glyma16g26630.1
Gossypium raimondiiGorai.007G228100.2Gorai.007G228100.1Gorai.007G068800.4Gorai.007G068800.2Gorai.007G068800.1
Gorai.007G057400.2Gorai.003G033600.1Gorai.008G094900.2Gorai.008G094900.1Gorai.013G072200.1
Gorai.005G208300.1Gorai.008G086800.1Gorai.009G337400.1Gorai.007G057400.1Gorai.007G068800.3
Gorai.003G052400.1Gorai.009G006300.1Gorai.005G113400.1Gorai.009G006400.1Gorai.011G034600.1
Gorai.005G025000.3Gorai.005G025000.2Gorai.005G113400.2Gorai.004G031100.1Gorai.002G150800.1
Gorai.004G030600.1Gorai.002G213300.1Gorai.004G030700.2Gorai.004G030500.1Gorai.009G079800.1
Gorai.007G057400.3Gorai.011G016500.1Gorai.010G177300.1Gorai.004G030700.1Gorai.009G158400.1
Gorai.010G074000.1Gorai.010G177300.2Gorai.007G068800.6
Linum usitatissimumLus10039643Lus10011597Lus10035654Lus10030923Lus10040121
Lus10003022Lus10011052Lus10039715Lus10018503Lus10020773
Lus10021638Lus10007349Lus10007348Lus10031586Lus10020772
Lus10000678Lus10028947Lus10011112Lus10010938Lus10031393
Lus10010939Lus10010936Lus10034098Lus10031392Lus10003048
Lus10004723Lus10012978Lus10030484Lus10015529Lus10008522
Lus10020000Lus10023221Lus10011982Lus10004580Lus10018365
Lus10007645
Malus domesticaMDP0000310152MDP0000269483MDP0000333317MDP0000661960MDP0000323987
MDP0000140678MDP0000398765MDP0000225088MDP0000873667MDP0000158544
MDP0000842877MDP0000320017MDP0000361876MDP0000258661MDP0000272671
MDP0000378203MDP0000132431MDP0000778955MDP0000264061MDP0000281777
MDP0000182058MDP0000151934MDP0000128432MDP0000173145MDP0000181544
Manihot esculentacassava4.1_013044mcassava4.1_013187mcassava4.1_013025mcassava4.1_013014mcassava4.1_012992m
cassava4.1_013520mcassava4.1_013942mcassava4.1_011585mcassava4.1_013011mcassava4.1_013342m
cassava4.1_013291mcassava4.1_013015mcassava4.1_013489mcassava4.1_032650mcassava4.1_013118m
cassava4.1_013286mcassava4.1_022330mcassava4.1_013165mcassava4.1_022350mcassava4.1_025832m
cassava4.1_027991mcassava4.1_016007mcassava4.1_012844m
Medicago truncatulaMedtr4g097670.1Medtr4g097640.1Medtr7g084770.1Medtr7g084760.1Medtr3g084630.1
Medtr3g084620.1Medtr4g126920.1Medtr7g084750.1Medtr7g093530.1Medtr8g102220.1
Medtr4g128580.1Medtr2g089140.1Medtr4g128410.1Medtr5g091730.1Medtr4g097700.1
Medtr2g038860.1Medtr4g128400.1Medtr4g128590.1Medtr8g102910.1Medtr6g088320.1
Medtr3g089540.1AC225528_49.1Medtr2g089140.2
Mimulus guttatusmgv1a011021mmgv1a011061mmgv1a011266mmgv1a011123mmgv1a011017m
mgv1a011641mmgv1a011611mmgv1a021830mmgv1a009848mmgv1a022549m
mgv1a009847mmgv1a023025mmgv1a011962mmgv1a018742mmgv1a022262m
mgv1a018934mmgv1a011220mmgv1a011275mmgv1a021219mmgv1a011456m
mgv1a011198mmgv1a010851mmgv1a021303m
Oryza sativaLOC_Os11g33270.1LOC_Os06g48160.1LOC_Os04g51520.1LOC_Os06g48170.1LOC_Os06g48200.1
LOC_Os04g53950.2LOC_Os07g34580.1LOC_Os06g48180.1LOC_Os04g51450.1LOC_Os08g14210.1
LOC_Os06g22919.4LOC_Os06g22919.3LOC_Os06g22919.2LOC_Os06g22919.1LOC_Os02g17900.1
LOC_Os02g17880.1LOC_Os04g51460.1LOC_Os08g13980.1LOC_Os08g14200.1
Panicum virgatumPavirv00001362mPavirv00009390mPavirv00058209mPavirv00006546mPavirv00053944m
Pavirv00047498mPavirv00052444mPavirv00064709mPavirv00052738mPavirv00060659m
Pavirv00038960mPavirv00054974mPavirv00040914mPavirv00035345mPavirv00066505m
Pavirv00038273mPavirv00022914mPavirv00036695mPavirv00058547mPavirv00033346m
Pavirv00045223mPavirv00047855mPavirv00059996mPavirv00032632mPavirv00050864m
Pavirv00009595mPavirv00009389mPavirv00045224mPavirv00026797mPavirv00009596m
Pavirv00034270m
Physcomitrella patensPp1s4_43V6.3Pp1s4_43V6.1Pp1s309_38V6.2Pp1s309_38V6.1Pp1s168_54V6.1
Pp1s168_29V6.1Pp1s291_89V6.1Pp1s193_16V6.1Pp1s618_1V6.1Pp1s26_126V6.1
Pp1s309_41V6.1Pp1s4_32V6.1Pp1s272_49V6.1Pp1s309_28V6.2Pp1s309_28V6.1
Phaseolus vulgarisPhvul.003G231900.1Phvul.011G107000.1Phvul.001G098200.1Phvul.004G062400.1Phvul.002G008400.1
Phvul.001G098300.1Phvul.003G147700.1Phvul.003G137600.1Phvul.005G111300.1Phvul.003G147400.1
Phvul.001G265300.1Phvul.003G147500.1Phvul.007G048300.1Phvul.009G233200.1Phvul.002G244000.1
Phvul.006G033800.1Phvul.004G168700.1Phvul.003G147300.1Phvul.002G311200.1Phvul.007G052800.1
Phvul.003G147600.1
Picea abiesMA_103594g0010MA_476450g0010MA_10428415g0010MA_10168001g0010MA_465930g0010
MA_8261658g0010MA_10251013g0010MA_8367646g0010MA_409361g0010MA_275059g0010
MA_39487g0010MA_10430695g0010MA_10432086g0010MA_144503g0010MA_148g0020
MA_17973g0010MA_19153g0010MA_10429607g0020MA_848882g0010MA_342978g0010
MA_11177g0010MA_10430703g0010MA_81735g0010MA_96657g0010MA_208401g0010
MA_10434153g0020
Populus trichocarpaPotri.007G008500.5Potri.007G008500.4Potri.007G008500.3Potri.007G008500.2Potri.007G008500.1
Potri.014G140300.1Potri.003G159700.3Potri.003G159700.1Potri.001G071000.1Potri.014G146100.1
Potri.002G060500.1Potri.T180200.1Potri.006G071200.1Potri.005G201200.1Potri.002G236200.1
Potri.013G005700.1Potri.018G095200.1Potri.018G095100.2Potri.018G095100.1Potri.013G152400.1
Potri.019G125000.1Potri.011G077300.1Potri.T112300.1Potri.002G060400.1Potri.006G170100.1
Potri.006G170000.1Potri.006G169900.1Potri.005G007200.1Potri.009G083800.1Potri.018G094900.1
Potri.018G094800.1Potri.004G021000.1Potri.011G077400.1Potri.T112400.1Potri.018G084300.1
Potri.006G160700.1Potri.011G025800.1Potri.003G159700.2
Prunus persicappa009472mppa009387mppa009863mppa009346mppa009871m
ppa020825mppa009608mppa009417mppa009792mppa009610m
ppa009350mppa017487mppa009685mppa015713mppa021675m
ppa026319mppa009365mppa021295mppa009245mppa010231m
Ricinus communis30131.m00693330128.m00859129615.m00048930179.m00057330065.m001165
30179.m00057429993.m00105529993.m00105629912.m00547627632.m000165
30179.m00056929693.m00209529693.m00209430099.m00166329842.m003641
Setaria italicaSi010796mSi026698mSi007018mSi006992mSi006487m
Si008187mSi010315mSi015709mSi030570mSi017963m
Si017966mSi007010mSi012626mSi015388mSi015312m
Si015667mSi010702mSi010719mSi014188m
Selaginella moellendorffii11041841336398543119243118035
9867497913267868233454140273
42292275136
Sorghum bicolorSb06g027670.1Sb05g020400.1Sb10g028550.1Sb10g028580.1Sb07g007010.1
Sb10g028570.1Sb10g028560.1Sb01g015620.1Sb06g029660.1Sb07g007460.1
Sb02g035160.1Sb04g010980.1Sb04g010760.1Sb10g019390.1Sb07g007020.1
Sb06g027680.1Sb06g027660.1Sb07g007450.1
Thellungiella halophilaThhalv10025884mThhalv10014262mThhalv10004708mThhalv10002626mThhalv10028859m
Thhalv10025705mThhalv10025941mThhalv10014301mThhalv10025720mThhalv10014326m
Thhalv10022791mThhalv10023177mThhalv10014316mThhalv10025909mThhalv10025933m
Thhalv10025803mThhalv10025892mThhalv10025934mThhalv10008296m
Vitis viniferaGSVIVT01000416001GSVIVT01029174001GSVIVT01029162001GSVIVT01029372001GSVIVT01001124001
GSVIVT01015345001.672.840GSVIVT01037018001GSVIVT01029172001GSVIVT01012635001GSVIVT01029163001
GSVIVT01029161001GSVIVT01029160001GSVIVT01029173001GSVIVT01029158001GSVIVT01029167001
GSVIVT01029175001GSVIVT01029166001GSVIVT01029165001GSVIVT01029171001GSVIVT01021359001
GSVIVT01021354001GSVIVT01031578001GSVIVT01031601001GSVIVT01031593001GSVIVT01029170001
Zea maysAC210669.3_FGT001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)