y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma18g01630.1
FamilyGH5
Protein PropertiesLength: 534 Molecular Weight: 59233.9 Isoelectric Point: 6.8217
ChromosomeChromosome/Scaffold: 18 Start: 914525 End: 917339
DescriptionCellulase (glycosyl hydrolase family 5) protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH5413521.49995e-41
  IVDGNATRVKLACVNWVSHLEYMVAEGLGERPLDGIAKEIKSMGFNCVRLTWPIYLITNDSLATLTVRQSFNNLGLPQAISALQVNNPSLIDLPLIKAYQ
  DVVKGLGDKGLMVILDNHVSKPQWCCSNDDGNGFFGDQYFDPDLWIKGLTKMATLFKGVTNVVAMSLRNELRGPRQNANDWFKYMPKGAEAVHGANPDVL
  VIMSGLNYDLDLSFLRKQQVKLSFSRKLVFELHWYSFSDGDSWTTENPNQVCGKVTGRVMRSAGYLLEQGYPLVLSEFGWDLRGTNQNDNSYFNCLLPLA
  AQLDFDWAYWTL
Full Sequence
Protein Sequence     Length: 534     Download
MGWSFPLSPL VTTITIVLLL CVTLQTKVVK AFPLYTQNRW IVDGNATRVK LACVNWVSHL    60
EYMVAEGLGE RPLDGIAKEI KSMGFNCVRL TWPIYLITND SLATLTVRQS FNNLGLPQAI    120
SALQVNNPSL IDLPLIKAYQ DVVKGLGDKG LMVILDNHVS KPQWCCSNDD GNGFFGDQYF    180
DPDLWIKGLT KMATLFKGVT NVVAMSLRNE LRGPRQNAND WFKYMPKGAE AVHGANPDVL    240
VIMSGLNYDL DLSFLRKQQV KLSFSRKLVF ELHWYSFSDG DSWTTENPNQ VCGKVTGRVM    300
RSAGYLLEQG YPLVLSEFGW DLRGTNQNDN SYFNCLLPLA AQLDFDWAYW TLAGSYYLRE    360
GTVGLIEVYG ILTQNTTLPT TTFLLQRISA IQLPYRGPGL SEVEAHKVIF HPLTGLCISG    420
KLEPLKLGPC SNSEGWEYTA QKVLSVKGRN STCLQAEGEG KEAKLGNECS VWEIVSDSKL    480
HLSSKINNAS DVCLDVDSNN NIVTNACKCL SGDKTCDPAS QWFKLVDSTR KST*          540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG2730BglC0.00364357333+
pfam00652Ricin_B_lectin7.0e-5413507112+
pfam00150Cellulase3.0e-1772352290+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAD31066.10315302507AC007357_15 F3F19.15 [Arabidopsis thaliana]
RefSeqXP_002285424.102753322533PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002312657.10275335516predicted protein [Populus trichocarpa]
RefSeqXP_002315653.10315332509predicted protein [Populus trichocarpa]
RefSeqXP_002515055.102953329538hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1vrx_B0.000000000000001353517320A Chain A, Endocellulase E1 From Acidothermus Cellulolyticus Mutant Y245g
PDB1vrx_A0.000000000000001353517320A Chain A, Endocellulase E1 From Acidothermus Cellulolyticus Mutant Y245g
PDB1ece_B0.000000000000009353517320A Chain A, Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose
PDB1ece_A0.000000000000009353517320A Chain A, Acidothermus Cellulolyticus Endocellulase E1 Catalytic Domain In Complex With A Cellotetraose
PDB3qhm_C0.000001132105201A Chain A, Crystal Analysis Of The Complex Structure, E342a-Cellotetraose, Of Endocellulase From Pyrococcus Horikoshii
Signal Peptide
Cleavage Site
31
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DY282456284313140
CB290890268453120
DY977776290653540
DY905374288663530
DY972279288313160
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_011_00429.2Aquca_011_00429.1Aquca_001_00170.1Aquca_001_00171.1Aquca_011_00425.1
Aquca_011_00424.1Aquca_011_00428.1Aquca_011_00423.1Aquca_001_00172.1
Arabidopsis lyrata471466322756864961488616326109
882032
Arabidopsis thalianaAT5G17500.1AT1G13130.1AT3G26140.1AT3G26130.1AT5G16700.1
Brachypodium distachyonBradi5g13560.1Bradi5g13550.1
Brassica rapaBra025186Bra019811Bra025187Bra026437Bra026436
Bra023580Bra013972Bra008603Bra026925
Carica papayaevm.model.supercontig_33.65evm.model.supercontig_33.69evm.model.supercontig_33.67
Capsella rubellaCarubv10008758mCarubv10019167mCarubv10016955mCarubv10002868m
Citrus clementinaCiclev10031098mCiclev10023534m
Citrus sinensisorange1.1g013842morange1.1g008330morange1.1g015062morange1.1g039248m
Cucumis sativusCucsa.286780.1Cucsa.275330.1Cucsa.115540.1Cucsa.108400.1Cucsa.115550.1
Cucsa.365480.1Cucsa.303610.1Cucsa.303620.1Cucsa.129000.1Cucsa.275320.1
Eucalyptus grandisEucgr.B03243.1Eucgr.H02462.1Eucgr.H02464.1Eucgr.H02457.1Eucgr.H02458.1
Eucgr.D01800.1
Glycine maxGlyma05g30691.1Glyma11g18350.1Glyma05g30681.1Glyma08g13880.2Glyma08g13891.1
Glyma08g06511.1Glyma07g08060.2
Gossypium raimondiiGorai.002G188600.1Gorai.012G173600.1
Linum usitatissimumLus10011404Lus10006462Lus10011403Lus10006461Lus10024686
Lus10032312
Malus domesticaMDP0000753366MDP0000729817
Manihot esculentacassava4.1_004696mcassava4.1_031675mcassava4.1_025125m
Medicago truncatulaMedtr4g091610.1Medtr7g012780.1Medtr7g012530.1Medtr3g086450.1Medtr7g012540.1
Medtr7g012840.1Medtr5g088330.1
Mimulus guttatusmgv1a004205mmgv1a018920mmgv1a020519mmgv1a004243mmgv1a004297m
Oryza sativaLOC_Os04g40510.2LOC_Os04g40510.1LOC_Os02g38260.1LOC_Os04g40500.1LOC_Os04g40490.1
Panicum virgatumPavirv00025159mPavirv00029795mPavirv00010845mPavirv00023661mPavirv00002791m
Pavirv00002936m
Physcomitrella patensPp1s94_121V6.1Pp1s114_176V6.1Pp1s298_71V6.1
Phaseolus vulgarisPhvul.002G258500.1Phvul.011G098000.1Phvul.002G258400.1Phvul.002G220300.1Phvul.010G095100.1
Picea abiesMA_318998g0010MA_463555g0010MA_8507901g0010MA_10432675g0010
Populus trichocarpaPotri.008G183400.2Potri.008G183400.1Potri.010G049700.1Potri.010G049800.1Potri.008G183400.3
Potri.001G097900.1Potri.T144300.1
Prunus persicappa003807m
Ricinus communis29929.m00479230190.m01129330190.m01129230190.m011291
Setaria italicaSi019475mSi009742mSi009751mSi009695m
Sorghum bicolorSb06g020270.1Sb06g020260.1Sb04g024910.1
Thellungiella halophilaThhalv10007253mThhalv10003934mThhalv10004045mThhalv10003968mThhalv10015581m
Thhalv10015466m
Vitis viniferaGSVIVT01000573001GSVIVT01019434001.470.783GSVIVT01019434001.470.783GSVIVT01019434001.35.351GSVIVT01019434001.35.351
GSVIVT01019433001GSVIVT01019436001GSVIVT01014359001GSVIVT01014358001GSVIVT01014355001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)