y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma18g01781.3
FamilyGH5
Protein PropertiesLength: 472 Molecular Weight: 52922.8 Isoelectric Point: 5.9296
ChromosomeChromosome/Scaffold: 18 Start: 1005796 End: 1011841
Description
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH51674461.79366e-43
  RHRNSFITIEDFKFLYKHGINTVRIPVGWWIAYDPDPPSPFIGGSLEALDNAFSWAQEYDIKCIIDLHAAPGSQNGMEHSASRDGFTGWPTSPDYISDSL
  YVIEFLVSRYARNPALLGIELLNEPSAATVSLDVLISYYKQGYQIVRKYSSSAYVIICQRIGVADPMELYQANIGSHNLVLDLHFYNLFDTFFNNMSAMD
  NIQYIYKSREGQLQALNNSNGPLILVGEWVNEWNVTNGSQKDYQDFARAQLDVYNAASFGWCYWTLKNDEKHWDFEWSIR
Full Sequence
Protein Sequence     Length: 472     Download
MGLVFTKWAC AFLLCCCLIT SGVYSVEGLH GGSKVRGVNL GGWLVIEGWI KPSLFDGIAN    60
GDMLDGTEVQ FKSVTLHKYV SAENGGGMNV TVDRDVPSSW ETFRLWRASE SEFQFRTSEG    120
QFLTCDGGGC SVSATAKSPS TSETYGIERN GKNRIHLKIK GGAYLQRHRN SFITIEDFKF    180
LYKHGINTVR IPVGWWIAYD PDPPSPFIGG SLEALDNAFS WAQEYDIKCI IDLHAAPGSQ    240
NGMEHSASRD GFTGWPTSPD YISDSLYVIE FLVSRYARNP ALLGIELLNE PSAATVSLDV    300
LISYYKQGYQ IVRKYSSSAY VIICQRIGVA DPMELYQANI GSHNLVLDLH FYNLFDTFFN    360
NMSAMDNIQY IYKSREGQLQ ALNNSNGPLI LVGEWVNEWN VTNGSQKDYQ DFARAQLDVY    420
NAASFGWCYW TLKNDEKHWD FEWSIRNNYL QLGKLYTFGG KLALPLLHVH L*            480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00257Fascin2.0e-106916597+
pfam00150Cellulase2.0e-21170435270+
COG2730BglC1.0e-24165455326+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0030674protein binding, bridging
GO:0051015actin filament binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI33153.10145360565unnamed protein product [Vitis vinifera]
RefSeqXP_002262875.10145348551PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002310872.10354581479predicted protein [Populus trichocarpa]
RefSeqXP_002438060.1024508509hypothetical protein SORBIDRAFT_10g007500 [Sorghum bicolor]
RefSeqXP_002533566.10144531488conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2pc8_A3e-2716544267376A Chain A, E292q Mutant Of Exo-B-(1,3)-Glucanase From Candida Albicans In Complex With Two Separately Bound Glucopyranoside Units At 1.8 A
PDB2pc8_A0.0032269249A Chain A, E292q Mutant Of Exo-B-(1,3)-Glucanase From Candida Albicans In Complex With Two Separately Bound Glucopyranoside Units At 1.8 A
PDB3n9k_A6e-2716535566257A Chain A, F229aE292S DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase From Candida Albicans In Complex With Laminaritriose At 1.7 A
PDB3n9k_A0.0032269148A Chain A, F229aE292S DOUBLE MUTANT OF EXO-Beta-1,3-Glucanase From Candida Albicans In Complex With Laminaritriose At 1.7 A
PDB2pbo_A6e-2716535567258A Chain A, E27q Mutant Of Exo-B-(1,3)-Glucanase From Candida Albicans At 1.85 A
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG8545172461654100
EX1670892631714330
CO0872742961293710
EX3721012571974530
DR9467482502034520
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00111.1Aquca_010_00110.1
Brachypodium distachyonBradi2g31690.1Bradi3g38500.1
Carica papayaevm.model.supercontig_55.63evm.model.supercontig_66.87evm.model.supercontig_20.222
Citrus clementinaCiclev10025463mCiclev10026955mCiclev10025415mCiclev10000913m
Citrus sinensisorange1.1g009560morange1.1g046395morange1.1g019395morange1.1g013777morange1.1g010600m
orange1.1g009475m
Cucumis sativusCucsa.104180.2Cucsa.104180.1
Eucalyptus grandisEucgr.I00417.1Eucgr.L01170.1Eucgr.L02139.1Eucgr.I00543.1Eucgr.I00415.1
Eucgr.F00486.1Eucgr.F00489.1Eucgr.F00489.3Eucgr.F00489.2Eucgr.F00487.1
Eucgr.L01169.1Eucgr.F00488.1Eucgr.I00415.2
Fragaria vescamrna16220.1-v1.0-hybridmrna16368.1-v1.0-hybridmrna22085.1-v1.0-hybridmrna16374.1-v1.0-hybrid
Glycine maxGlyma11g37881.1Glyma18g01781.2Glyma18g01781.1Glyma06g47761.6Glyma06g47761.1
Glyma06g47761.5Glyma06g47761.2Glyma06g47761.8Glyma06g47761.4Glyma06g47761.7
Glyma06g47761.3Glyma13g02030.2Glyma06g47750.1Glyma13g02000.1Glyma08g14676.1
Glyma05g31460.1Glyma14g34450.1
Gossypium raimondiiGorai.009G239600.6Gorai.009G239600.5Gorai.009G239600.4Gorai.009G239600.1Gorai.009G239600.3
Gorai.009G239600.2Gorai.009G239600.7Gorai.011G110800.2Gorai.011G110800.1Gorai.003G041900.1
Gorai.003G044300.1Gorai.003G044000.4Gorai.003G044000.5Gorai.003G044200.1Gorai.003G044000.3
Gorai.003G044000.2Gorai.003G044000.1
Linum usitatissimumLus10041110Lus10036436
Malus domesticaMDP0000319015MDP0000123200MDP0000133367
Manihot esculentacassava4.1_007845mcassava4.1_026104mcassava4.1_006238m
Medicago truncatulaMedtr3g009020.1Medtr3g086750.1Medtr3g009030.1Medtr5g062290.1Medtr3g008960.1
Medtr5g062190.1Medtr3g009010.1Medtr8g091310.1
Mimulus guttatusmgv1a004896mmgv1a019918m
Oryza sativaLOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22570.1.193.483LOC_Os10g22520.1LOC_Os10g22570.1.671.954
LOC_Os10g22570.1.671.954LOC_Os10g22570.1.671.954LOC_Os05g15510.2LOC_Os05g15510.1LOC_Os08g37750.1
Panicum virgatumPavirv00046245mPavirv00011301mPavirv00018291mPavirv00046244mPavirv00011300m
Pavirv00028658mPavirv00000970mPavirv00042459mPavirv00046564m
Physcomitrella patensPp1s304_43V6.1
Phaseolus vulgarisPhvul.001G254400.1Phvul.008G171300.1Phvul.002G261800.1Phvul.008G171400.1
Picea abiesMA_10427061g0010MA_479818g0010MA_4911g0010MA_14445g0010MA_23595g0010
Populus trichocarpaPotri.007G010000.1Potri.005G167800.1Potri.007G089400.1Potri.007G089400.2Potri.005G078500.1
Potri.002G093000.1
Prunus persicappa023601mppa005425mppa019648m
Ricinus communis29810.m00014529908.m00599427889.m00017327905.m00007336339.m000016
Setaria italicaSi035257mSi006205mSi021695mSi021671mSi039329m
Si013558mSi035337m
Selaginella moellendorffii12682742658240418324801
Sorghum bicolorSb10g007500.1Sb09g008170.1Sb01g024390.1Sb10g008480.1
Vitis viniferaGSVIVT01003438001GSVIVT01006372001GSVIVT01006369001GSVIVT01002801001GSVIVT01008995001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)