y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma18g11480.2
FamilyCE10
Protein PropertiesLength: 675 Molecular Weight: 75408.5 Isoelectric Point: 4.5792
ChromosomeChromosome/Scaffold: 18 Start: 10215862 End: 10224535
Descriptionalpha/beta-Hydrolases superfamily protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE104296472e-30
  QASKEEKPPLLLKSHGGPTQETRGILNLSVQYWTSRGWAVVDVNYGGSTGYGRVYRERLLRQWGIVDVNDCCSCATYLVDSGKVDKERLCIMGGSAGGYT
  TLAVLAFRDTFQAGASLYGIADLNLLRAETHKFESHYVENLVGDDKDMYERSPINHVDNFSCPIIIFQGLEDKVVPPDQARKIYQAVKEKGVPVALVEYE
  GEQHGFRKAENIKFTLEQE
Full Sequence
Protein Sequence     Length: 675     Download
MAFSTATVTT APYGSWKSPI TSDDVSGATK DLGGTTIDGR GRLIWLEFRP TESGRGVLVL    60
EPENNGGEAV DITPKEFGVR TLAQEYGGGA FTVSGDVVFF ANYNDQRLYK QSISSLDVPP    120
VPLTPDYGGP LVSYADGRLD ARFNRFISVR EDRRESSLNP PTTIVSIALG SKDLQEPEVL    180
VSGSDFYAFP RLDSKSERIT WIQWNHPSMP WDKTELWVGY ISENGEIYKR VCIAGNDPSR    240
VESPTEPKWS LDGELFFVTD KENGFWNIHK WIEFENKVVS VYSLEAEFTR PLWTYGMNSY    300
EFVESSKQKN LIACSYRQHG KSYLGIIDVQ GSKLTVIDFP CTDINNITSG NDCLYVEGAS    360
EVLPSSVAKV TFDDDKSKAV DFNIIWSSSP DSLKYSSYIS KPEFIEFPTE VPGQNAYAYF    420
YPPSNPDFQA SKEEKPPLLL KSHGGPTQET RGILNLSVQY WTSRGWAVVD VNYGGSTGYG    480
RVYRERLLRQ WGIVDVNDCC SCATYLVDSG KVDKERLCIM GGSAGGYTTL AVLAFRDTFQ    540
AGASLYGIAD LNLLRAETHK FESHYVENLV GDDKDMYERS PINHVDNFSC PIIIFQGLED    600
KVVPPDQARK IYQAVKEKGV PVALVEYEGE QHGFRKAENI KFTLEQEMVF FARLIGHFDV    660
ADDITPIKID NFDD*                                                     720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam12695Abhydrolase_52.0e-9442629188+
COG0657Aes2.0e-10402634264+
COG0412COG04122.0e-10402634243+
pfam00326Peptidase_S92.0e-49458656204+
COG1506DAP22.0e-64132658534+
Gene Ontology
GO TermDescription
GO:0006508proteolysis
GO:0008152metabolic process
GO:0008236serine-type peptidase activity
GO:0016787hydrolase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_198470.30867367729serine-type peptidase [Arabidopsis thaliana]
RefSeqXP_002284254.10967313677PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002284264.101067312675PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002302446.101067318672predicted protein [Populus trichocarpa]
RefSeqXP_002510270.10467262730acylamino-acid-releasing enzyme, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3azo_B086562649A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azo_A086562649A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azq_B086562649A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azq_A086562649A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azp_B086562649A Chain A, Crystal Structure Of Puromycin Hydrolase S511a Mutant
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7802165491356730
DV7110393073426480
DV7111723013426420
DV7072662953426360
GO8785023422135540
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00583.4Aquca_017_00583.3Aquca_017_00583.2Aquca_017_00583.1Aquca_015_00163.1
Arabidopsis lyrata915409859721
Arabidopsis thalianaAT4G14570.1AT5G36210.1
Brachypodium distachyonBradi3g26780.4Bradi3g26780.3Bradi3g26780.2Bradi3g26787.1Bradi1g45890.1
Brassica rapaBra039731Bra036867Bra037063Bra030822
Capsella rubellaCarubv10006608mCarubv10013057mCarubv10012695mCarubv10013077mCarubv10004231m
Chlamydomonas reinhardtiiCre05.g241650.t1.3Cre10.g423300.t1.1
Citrus clementinaCiclev10004377mCiclev10004325mCiclev10003676m
Citrus sinensisorange1.1g005093morange1.1g004149morange1.1g004141morange1.1g003363morange1.1g004816m
orange1.1g004757morange1.1g004756morange1.1g004735m
Cucumis sativusCucsa.386660.1Cucsa.123480.1Cucsa.123460.1
Eucalyptus grandisEucgr.H00222.1Eucgr.H00221.1Eucgr.F00026.5Eucgr.F00026.4Eucgr.F00026.3
Eucgr.F00026.2Eucgr.F00026.1Eucgr.F00028.1Eucgr.F00027.2Eucgr.F00027.1
Eucgr.L02208.1Eucgr.F00027.3Eucgr.F00025.1
Fragaria vescamrna29072.1-v1.0-hybridmrna32579.1-v1.0-hybridmrna09045.1-v1.0-hybridmrna09044.1-v1.0-hybrid
Glycine maxGlyma10g00350.1Glyma10g00320.1Glyma08g42730.1Glyma18g11480.3Glyma18g11480.4
Gossypium raimondiiGorai.006G245500.5Gorai.006G245500.4Gorai.006G245500.3Gorai.006G245500.1Gorai.010G016900.1
Linum usitatissimumLus10039405Lus10015363Lus10032765Lus10021758
Malus domesticaMDP0000211874MDP0000304250MDP0000251803
Manihot esculentacassava4.1_002075mcassava4.1_031105mcassava4.1_005468m
Medicago truncatulaAC233668_48.1Medtr5g042400.2Medtr5g042400.1Medtr5g042410.1Medtr3g051310.1
Mimulus guttatusmgv1a001402mmgv1a001397mmgv1a002403m
Oryza sativaLOC_Os10g28020.3LOC_Os10g28020.1LOC_Os10g28020.2LOC_Os10g28030.2LOC_Os10g28030.1
LOC_Os06g11180.1
Panicum virgatumPavirv00008779mPavirv00061808mPavirv00015591mPavirv00045661mPavirv00003810m
Pavirv00003809m
Physcomitrella patensPp1s619_3V6.1Pp1s97_68V6.1Pp1s108_134V6.1Pp1s9_317V6.2Pp1s9_317V6.1
Pp1s139_36V6.2Pp1s139_36V6.1
Phaseolus vulgarisPhvul.007G279900.1Phvul.007G280000.1Phvul.006G042600.1Phvul.006G042700.1
Populus trichocarpaPotri.008G160400.1Potri.002G128700.9Potri.002G128700.8Potri.002G128700.7Potri.002G128700.6
Potri.002G128700.5Potri.002G128700.4Potri.002G128700.3Potri.002G128700.2Potri.002G128700.10
Potri.002G128700.1
Prunus persicappa001729mppa002365m
Ricinus communis29844.m00318230170.m01392428323.m000042
Setaria italicaSi034264mSi034356mSi006001mSi005937mSi005954m
Selaginella moellendorffii16830378836
Sorghum bicolorSb01g021970.4Sb01g021970.2Sb01g021970.1Sb01g021970.5Sb01g021960.1
Sb01g021970.3Sb10g007280.1Sb10g007270.1
Thellungiella halophilaThhalv10024477mThhalv10003712m
Vitis viniferaGSVIVT01018091001GSVIVT01009564001GSVIVT01009565001
Volvox carteriVocar20006950m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)