y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma18g13105.1
FamilyGT48
Protein PropertiesLength: 1917 Molecular Weight: 222722 Isoelectric Point: 7.8627
ChromosomeChromosome/Scaffold: 18 Start: 12547352 End: 12631910
Descriptionglucan synthase-like 7
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT48104117700
  VPQNLEARRRITFFANSLFMNMPKAPKVRNMLSVSILTPYYKQDVLYSDADLNSENEDGISLLFYLTKMYPDEWANFHERLKSEGLEKDTDELICQWASY
  RGQTLYRTVRGMMYYWQALILQCFIESAGDIALTEGYSDKNKNLYEDAQAMADLKFTYVISSQLYGSLKSSKYARDRNCYHNILSLMLKHSSLRVAYIDE
  TEETKDGKSHKVYSSVLVKGGIRFDEEIYRIKLPGPPTLIGEGIPENQNHAIIFTRGEALQTRDMNQDNYYEESFKMRNVLEEFRKEHNGQRKPTILGIR
  EHIFTGSVSSLACFMSNEKTSLVTIGHRILANPLRVRFHYGHSDIFDRIFHITRGGISKASKVINLNQDIFAGFNTTLRQGFITHHEYIQVGKGHDTGMN
  QISLYEAKDAIGNGEQTLSRDVYRLGQRFDFYRMLSFYFTTVGFYFSSMITVLTVYVFLYGRIYVVLSGVEREILQNRNIHQSKTLEEALATQSIVQLGL
  LLVLPMVMEIGLEKGFRTALGDFIIMQLQLASVFFTFQLGTKAHYYGRTLLHGGSKYRPTGRGFVVFHATFADNYRRYSRSHFVKGLEILILLIVYEVYG
  SSYRSSHLYLFITISMWFLATSWLFAPFLFNPYGFDWQKTVDDWTDWKRWMGNRGGIGISPHKSWEFWWDEENDHLKYSNLRGKILEIILAFRFFVYQYG
  IVYHMDITHHNKDLLVFGLSWAALIIIFIL
Full Sequence
Protein Sequence     Length: 1917     Download
MAQRVLFEID KQPSKRLVNG DKSPVNQGTQ SLSHIPAVIR RLLDRNPNRR LMNADKSPIP    60
VDQASIELGV EPGMVDSEVV PSSIAVLVPI LRAANEIEEE NPRVAYLCRF HAFKKAHSMD    120
PTSSGPGVRQ FKCYLLHKLE KEEELTARHA LRTDARELQT YYQHFYEKKI RDGEFNQRPE    180
EMAKNVQIAT VLYEVLKTMV SPQNIEEKTR RYAEDVEHKR GRYEHYNILP LYAVGVKPAI    240
MELPEIKAAI AALCNVDNLP MPIIHARPDD STVPMERLKE VNDILDWIAF VFGFQKGNVA    300
NQREHLILLL ANMNIGDRAE SSHQLHSETV EKLKATILKN YESWCHYVHC EDNLRFLEDY    360
DMQQIELIYI ALYLLIWGEA SNIRFMPECL CYIFHHMCHE VYKILCKNPS HVTGSTELEE    420
GRDDEYFLRE VITPIYQVLM KEAERNNRGR ASHSNWRNYD DLNEYFWSKK CFDDLKWPLN    480
PKADFFRHLD ETQRSIRGHR QTSTGVGKRK PKTNFVEVRT FLHLYRSFDR MWIFFILALQ    540
AMIIIAWSSL RPVRVFFDAD VFRNVMTIFI TYAFLNFLQA TLDIILTWNA LKNMKFTQWL    600
RYFLKFFVAA VWIIVLPVSY SSSSQNPSGL VKFGTSWAGH WRNESLYTYV VVLYMLPNIV    660
AAILFFLPPL RKKLEQYTLF WIMLLISKLA FSYYVEILPL VGPTKLIMGM SIDNYQWHEF    720
FPENETHNIC VVIAIWAPII LVYFMDTQIW YAIYATLLGV IVGAVGHLGE IRTLEMLRSR    780
FQSVPGAFSL RFWTGRDTKT KQVELDETYE RNNISYFSQF WNEFINSMRE EDLISDRDRD    840
FLLIPYSSTH VSVIQWPPFL LASKIPIAVD MAKDYTKKTD DDLYKKIRSD GYMFSAVIEC    900
YETLKDIILK LLLDEDDRLA VSSICAKVER SIREETFVKE FKMSGLPSLI DKFGEFVTEL    960
QSEDGKRQSK IVNVLQDIVE IITQDVMVDG HLFPQTLQEY HVDRRQRFVN IDTSFTGNES    1020
VMGKVIRLHL LLTVKDSAIN VPQNLEARRR ITFFANSLFM NMPKAPKVRN MLSVSILTPY    1080
YKQDVLYSDA DLNSENEDGI SLLFYLTKMY PDEWANFHER LKSEGLEKDT DELICQWASY    1140
RGQTLYRTVR GMMYYWQALI LQCFIESAGD IALTEGYSDK NKNLYEDAQA MADLKFTYVI    1200
SSQLYGSLKS SKYARDRNCY HNILSLMLKH SSLRVAYIDE TEETKDGKSH KVYSSVLVKG    1260
GIRFDEEIYR IKLPGPPTLI GEGIPENQNH AIIFTRGEAL QTRDMNQDNY YEESFKMRNV    1320
LEEFRKEHNG QRKPTILGIR EHIFTGSVSS LACFMSNEKT SLVTIGHRIL ANPLRVRFHY    1380
GHSDIFDRIF HITRGGISKA SKVINLNQDI FAGFNTTLRQ GFITHHEYIQ VGKGHDTGMN    1440
QISLYEAKDA IGNGEQTLSR DVYRLGQRFD FYRMLSFYFT TVGFYFSSMI TVLTVYVFLY    1500
GRIYVVLSGV EREILQNRNI HQSKTLEEAL ATQSIVQLGL LLVLPMVMEI GLEKGFRTAL    1560
GDFIIMQLQL ASVFFTFQLG TKAHYYGRTL LHGGSKYRPT GRGFVVFHAT FADNYRRYSR    1620
SHFVKGLEIL ILLIVYEVYG SSYRSSHLYL FITISMWFLA TSWLFAPFLF NPYGFDWQKT    1680
VDDWTDWKRW MGNRGGIGIS PHKSWEFWWD EENDHLKYSN LRGKILEIIL AFRFFVYQYG    1740
IVYHMDITHH NKDLLVFGLS WAALIIIFIL LKASQMVSLK RQRIGTDFNL MFRILKALRF    1800
LGFLAVMTVL FVVYGLTISD LLAAIISFMP SGWAIILIAQ TFKVCLKGSQ LWDSVKELSR    1860
AYEYVMGLII FLPIVILSWV PHASECQTRL LFNEAFSRGL QISMILAGKW AAYKSD*       1920
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam04652DUF6050.000487214135+
pfam14288FKS1_dom12.0e-47377478102+
pfam02364Glucan_synthase010411753798+
Gene Ontology
GO TermDescription
GO:00001481,3-beta-D-glucan synthase complex
GO:00038431,3-beta-D-glucan synthase activity
GO:0006075(1->3)-beta-D-glucan biosynthetic process
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_191469.2031190941925ATGSL11 (glucan synthase-like 11); 1,3-beta-glucan synthase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
Swiss-ProtQ9LYS6031190941912CALS6_ARATH RecName: Full=Putative callose synthase 6; AltName: Full=1,3-beta-glucan synthase; AltName: Full=Protein GLUCAN SYNTHASE-LIKE 11
RefSeqXP_002300874.10361909151911predicted protein [Populus trichocarpa]
RefSeqXP_002307554.10451909151926predicted protein [Populus trichocarpa]
RefSeqXP_002526651.10711909371900transferase, transferring glycosyl groups, putative [Ricinus communis]
Metabolic Pathways
Pathway NameReactionECProtein Name
callose biosynthesis13-BETA-GLUCAN-SYNTHASE-RXNEC-2.4.1.341,3-β-glucan synthase
Transmembrane Domains
StartEnd
365387
531550
565587
599621
645667
679701
725744
749771
14771499
16211643
16481670
17251742
17571779
18001818
18221844
18641883
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO425519628128619090
HO780746512107115670
HO780496339134116790
HO780496133122113400
HO780496207166818732.8026e-45
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_056_00094.1Aquca_014_00906.1Aquca_019_00181.4Aquca_019_00181.3Aquca_019_00181.1
Aquca_016_00166.1Aquca_019_00181.2Aquca_084_00016.4Aquca_084_00016.3Aquca_084_00016.2
Aquca_084_00016.1Aquca_022_00132.2Aquca_022_00132.1Aquca_014_00908.4Aquca_014_00908.3
Aquca_014_00908.2Aquca_014_00908.1Aquca_014_00908.5Aquca_008_00266.1Aquca_039_00091.4
Aquca_039_00091.2Aquca_039_00091.1Aquca_039_00091.3Aquca_056_00094.2
Arabidopsis lyrata340908482666470669899601907409
878725482124490214490142897726
325786
Arabidopsis thalianaAT3G07160.1AT2G36850.1AT1G06490.1AT4G03550.1AT2G13680.1
AT1G05570.2AT1G05570.1AT4G04970.1AT3G59100.1AT2G31960.2
AT2G31960.1AT5G13000.1AT5G13000.2AT3G14570.2AT3G14570.1
AT5G36870.1
Brachypodium distachyonBradi1g51757.1Bradi1g77247.2Bradi1g77247.1Bradi1g47427.1Bradi2g50140.1
Bradi3g60790.2Bradi3g60790.1Bradi1g29622.1Bradi1g76617.1Bradi2g46250.1
Bradi2g40460.1Bradi3g09317.1Bradi2g40430.1
Brassica rapaBra005239Bra029628Bra001239Bra040364Bra015504
Bra034218Bra032416Bra037213Bra029541Bra015436
Bra003364Bra023386Bra008864Bra005624Bra027328
Carica papayaevm.model.supercontig_42.151evm.model.supercontig_189.7evm.model.supercontig_25.167evm.model.supercontig_858.3evm.model.supercontig_2050.2
evm.model.supercontig_3407.1evm.model.supercontig_50.100evm.model.supercontig_4.57
Capsella rubellaCarubv10022498mCarubv10022499m
Citrus clementinaCiclev10014066mCiclev10018457mCiclev10018456mCiclev10000018mCiclev10018223m
Ciclev10030477mCiclev10030476mCiclev10014015mCiclev10030481mCiclev10030478m
Ciclev10030495mCiclev10024186mCiclev10030599mCiclev10030560mCiclev10030796m
Citrus sinensisorange1.1g000946morange1.1g000813morange1.1g000382morange1.1g000253morange1.1g000219m
orange1.1g000179morange1.1g000260morange1.1g000273morange1.1g000180morange1.1g000261m
orange1.1g045737morange1.1g000259morange1.1g000258morange1.1g001004morange1.1g000585m
orange1.1g000171morange1.1g000349morange1.1g000165morange1.1g001473morange1.1g000389m
orange1.1g000385morange1.1g040336morange1.1g000763m
Cucumis sativusCucsa.157510.4Cucsa.157510.3Cucsa.157510.2Cucsa.157510.1Cucsa.142920.1
Cucsa.249900.1Cucsa.119100.1Cucsa.126670.1Cucsa.239610.1Cucsa.049980.10
Cucsa.142930.1Cucsa.049980.1Cucsa.058220.1Cucsa.058230.1
Eucalyptus grandisEucgr.B00160.1Eucgr.B03640.2Eucgr.B03640.1Eucgr.I00208.1Eucgr.K01028.4
Eucgr.K01028.3Eucgr.K01028.2Eucgr.K01028.1Eucgr.D00621.1Eucgr.A01821.1
Eucgr.K01027.1Eucgr.D00622.1Eucgr.J00836.1Eucgr.J00827.1Eucgr.F01403.1
Eucgr.A01827.1Eucgr.A02008.1Eucgr.A01817.1Eucgr.A01994.2Eucgr.A01994.1
Eucgr.A02010.1Eucgr.J00836.2Eucgr.A01997.1
Fragaria vescamrna09912.1-v1.0-hybridmrna17912.1-v1.0-hybridmrna17710.1-v1.0-hybridmrna28731.1-v1.0-hybridmrna02397.1-v1.0-hybrid
mrna24411.1-v1.0-hybridmrna26782.1-v1.0-hybridmrna28728.1-v1.0-hybrid.526.840mrna28728.1-v1.0-hybrid.526.840
Glycine maxGlyma06g18216.1Glyma04g36725.1Glyma20g38860.1Glyma10g44150.1Glyma05g32500.4
Glyma05g32500.3Glyma05g32500.2Glyma08g16660.1Glyma04g39120.2Glyma04g39120.1
Glyma13g37290.2Glyma08g42150.3Glyma08g42150.2Glyma08g42150.1Glyma18g12870.3
Glyma18g12870.2Glyma18g12870.1Glyma15g08020.3Glyma15g08020.2Glyma15g08020.1
Glyma15g42330.4Glyma15g42330.3Glyma15g42330.2Glyma18g53823.1Glyma08g47670.1
Glyma08g47670.2Glyma18g13105.9Glyma18g13105.8Glyma18g13105.7Glyma18g13105.6
Glyma18g13105.10Glyma18g13105.3Glyma18g13105.2Glyma18g13105.5Glyma18g13105.4
Glyma15g39420.2Glyma13g33560.1Glyma05g32500.6Glyma05g32500.5Glyma08g42110.1
Glyma06g44770.3Glyma06g44770.2Glyma13g31310.1Glyma06g44770.4Glyma10g44150.2
Glyma08g16715.1Glyma06g15860.1.320.682Glyma06g15860.1.320.682Glyma08g16730.2
Gossypium raimondiiGorai.004G018200.3Gorai.004G018200.1Gorai.004G018200.2Gorai.003G109000.6Gorai.003G109000.1
Gorai.003G109000.2Gorai.003G109000.3Gorai.003G109000.4Gorai.011G120300.1Gorai.005G201500.2
Gorai.005G201500.1Gorai.011G119900.1Gorai.013G075600.1Gorai.004G092500.3Gorai.004G092500.2
Gorai.004G092500.1Gorai.011G096900.3Gorai.011G096900.1Gorai.004G092600.3Gorai.004G092600.1
Gorai.009G169700.3Gorai.009G169700.2Gorai.009G169700.1Gorai.012G187400.3Gorai.012G187400.2
Gorai.012G187400.1Gorai.004G092600.2Gorai.004G092600.4Gorai.012G040000.2Gorai.012G040000.1
Gorai.005G042700.1Gorai.005G043100.1Gorai.012G128700.1Gorai.007G334800.1Gorai.007G334800.2
Gorai.003G109000.5
Linum usitatissimumLus10014796Lus10032463Lus10039828Lus10000266Lus10031648
Lus10033689Lus10001424Lus10001056Lus10003920Lus10039199
Lus10037469Lus10013744Lus10033483Lus10007327Lus10030030
Lus10042478Lus10020893Lus10020750Lus10040891.301.669Lus10040891.301.669
Lus10002096Lus10002097
Malus domesticaMDP0000174437MDP0000286691MDP0000245319MDP0000275961MDP0000915307
MDP0000229527MDP0000230907MDP0000203763MDP0000321472MDP0000220467
MDP0000308574MDP0000198973MDP0000230621MDP0000212172.415.839MDP0000212172.415.839
MDP0000372473MDP0000310065MDP0000213931MDP0000218486.624.863MDP0000218486.624.863
MDP0000218486.624.863
Manihot esculentacassava4.1_001919mcassava4.1_031653mcassava4.1_029201mcassava4.1_000111mcassava4.1_000342m
cassava4.1_000112mcassava4.1_000082mcassava4.1_026004mcassava4.1_002527mcassava4.1_003374m
cassava4.1_003342mcassava4.1_006866mcassava4.1_028751mcassava4.1_033421m
Medicago truncatulaMedtr4g078220.1Medtr3g047390.1Medtr7g005950.1Medtr1g116370.1AC235753_1023.1
Medtr1g116470.1.521.981Medtr1g116470.1.521.981Medtr1g116470.1.228.504Medtr1g116470.1.228.504
Mimulus guttatusmgv1a000080mmgv1a000075mmgv1a000084mmgv1a000082mmgv1a000070m
mgv1a000067mmgv1a000108mmgv1a024191mmgv1a000066mmgv1a000106m
mgv1a000068m
Oryza sativaLOC_Os06g08380.1LOC_Os02g58560.1LOC_Os01g55040.1LOC_Os06g51270.1LOC_Os03g03610.3
LOC_Os03g03610.2LOC_Os03g03610.1LOC_Os02g58560.3LOC_Os02g14900.1LOC_Os01g34930.1
LOC_Os01g48200.1LOC_Os01g34890.1LOC_Os01g34880.1
Panicum virgatumPavirv00009928mPavirv00009617mPavirv00009495mPavirv00057448mPavirv00022973m
Pavirv00045342mPavirv00015084mPavirv00020404mPavirv00041942mPavirv00010502m
Pavirv00026821mPavirv00007196mPavirv00061397mPavirv00045035mPavirv00040188m
Pavirv00056028mPavirv00049749mPavirv00048524mPavirv00058599m
Physcomitrella patensPp1s88_136V6.1Pp1s160_88V6.1Pp1s40_186V6.2Pp1s67_234V6.1Pp1s67_70V6.1
Pp1s145_49V6.1Pp1s18_300V6.2Pp1s199_13V6.1Pp1s13_132V6.1Pp1s13_432V6.1
Pp1s379_24V6.1Pp1s66_72V6.1
Phaseolus vulgarisPhvul.007G004900.2Phvul.007G004900.1Phvul.007G004900.3Phvul.002G272000.1Phvul.009G150300.2
Phvul.009G150300.1Phvul.011G113800.1Phvul.006G185600.2Phvul.006G185600.1Phvul.006G032100.1
Phvul.006G031900.1Phvul.005G103600.1Phvul.008G002300.1Phvul.005G040900.2Phvul.007G005100.1
Phvul.005G040900.1Phvul.005G062500.1Phvul.009G169400.1
Picea abiesMA_10428413g0040MA_826577g0010MA_960362g0010MA_10426974g0030MA_735748g0010
MA_6205g0020MA_10426974g0020MA_10430560g0010MA_10431062g0010MA_229544g0010
MA_10434444g0010MA_10431631g0010
Populus trichocarpaPotri.015G089300.1Potri.001G011900.1Potri.005G058300.2Potri.005G058300.1Potri.013G131300.1
Potri.001G230000.9Potri.001G230000.8Potri.001G230000.7Potri.001G230000.6Potri.001G230000.5
Potri.001G230000.4Potri.001G230000.3Potri.001G230000.2Potri.001G230000.17Potri.001G230000.16
Potri.011G052400.6Potri.011G052400.5Potri.011G052400.4Potri.011G052400.3Potri.011G052400.2
Potri.011G052400.1Potri.002G058700.3Potri.002G058700.2Potri.002G058700.1Potri.001G012200.3
Potri.001G012200.1Potri.001G012200.2Potri.005G203500.2Potri.005G203500.1Potri.003G214200.2
Potri.003G214200.1Potri.011G095100.2Potri.011G095100.1Potri.001G230000.10Potri.001G230000.18
Potri.001G012200.5Potri.001G012200.4Potri.005G203500.3Potri.001G230000.11Potri.001G230000.12
Potri.001G230000.13
Prunus persicappa000071mppa000167mppa000077mppa000074mppa001863m
ppa000121mppa000112mppa002267mppa000073mppa003008m
ppa000306m
Ricinus communis30147.m01381228035.m00035829691.m00028229983.m00319129734.m000419
28035.m00035929759.m00028130226.m00202329983.m00319229851.m002416
Setaria italicaSi033860mSi034369mSi034352mSi008368mSi016068m
Si016067mSi000021mSi000023mSi000022mSi000017m
Si033956mSi033893mSi033872mSi016150mSi000059m
Selaginella moellendorffii133452439692163802267830177798
449402
Sorghum bicolorSb10g005550.1Sb04g038510.1Sb10g030970.1Sb01g048630.1Sb03g023490.1
Sb03g030800.1Sb03g034880.1Sb04g008830.1
Thellungiella halophilaThhalv10019878mThhalv10016126mThhalv10006529mThhalv10022518mThhalv10028360m
Thhalv10028359mThhalv10006533mThhalv10006528mThhalv10016125mThhalv10012412m
Thhalv10005734mThhalv10019876mThhalv10029222m
Vitis viniferaGSVIVT01025370001GSVIVT01007560001GSVIVT01026489001GSVIVT01001361001GSVIVT01020854001
GSVIVT01025362001GSVIVT01000622001GSVIVT01005204001GSVIVT01020548001.494.863GSVIVT01020548001.494.863
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)