y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma18g20600.2
FamilyCBM45
Protein PropertiesLength: 1460 Molecular Weight: 164062 Isoelectric Point: 6.7426
ChromosomeChromosome/Scaffold: 18 Start: 22610581 End: 22630992
DescriptionPyruvate phosphate dikinase, PEP/pyruvate binding domain
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM454525318.5e-22
  LHWALSRTSEEWLVPPETALPPGSVTMNEAAETPFKAGSSSHPSYEVQSLDIEVDDDTFKGIPFVILSDGEWIKNNGSNF
CBM451231984.7e-24
  LHWGVVRDQPGKWVLPSRHPDGTKNYKSRALRTPFVKSDSGSFLKIEIDDPAAQAIEFLILDEAKNKWFKNNGENF
Full Sequence
Protein Sequence     Length: 1460     Download
MSQSIFHQTV LCQTQTVAEH QSKVSSLEVS ANKGKKNLFL TPTNFRGSRL CVRKRKLTMG    60
RHHHRHVDAV PRAVLTTNLA SELSGKFNLD GNIELQIAVS SSEPGAARQV DFKVSYNSES    120
LLLHWGVVRD QPGKWVLPSR HPDGTKNYKS RALRTPFVKS DSGSFLKIEI DDPAAQAIEF    180
LILDEAKNKW FKNNGENFHI KLPVKSKLSQ EVSVPEDLVQ IQAYLRWERK GKQMYTPEQE    240
KEEYEAARNE LLEEVARGTS VQDLHARLTK KTKAAEVKEP SVSETKTIPD ELVQIQAFIR    300
WEKAGKPNYS REQQLMEFEE ARKELLEELE KGASLDAIRK KIVKGEIQTK VAKQLKTKKY    360
FRAERIQRKK RDLMQLINRN VAQNIVEQVI DAPKALTVIE HYANAREEYE SGPVLNKTIY    420
KLGDNYLLVL VTKDAGKIKV HLATDSKKPF TLHWALSRTS EEWLVPPETA LPPGSVTMNE    480
AAETPFKAGS SSHPSYEVQS LDIEVDDDTF KGIPFVILSD GEWIKNNGSN FYIEFGGKKQ    540
KQKDFGNGKG TAKFLLNKIA EMESEAQKSF MHRFNIASDL IDEAKNAGQL GLAGILVWMR    600
FMATRQLIWN KNYNVKPREI SKAQDRLTDL LQDVYANYPQ YREIVRMILS TVGRGGEGDV    660
GQRIRDEILV IQRNNDCKGG MMEEWHQKLH NNTSPDDVVI CQALIDYINS DFDIGVYWKA    720
LNDNGITKER LLSYDRAIHS EPNFRRDQKE GLLRDLGNYM RTLKAVHSGA DLESAISNCM    780
GYKSEGQGFM VGVKINPVPG LPTGFPELLE FVMEHVEEKN VEPLLEGLLE ARQELQPSLS    840
KSQSRLKDLI FLDVALDSTV RTAVERSYEE LNNAGPEKIM YFISLVLENL ALSSDDNEDL    900
IYCLKGWDVA LSMCKIKDTH WALYAKSVLD RTRLALTNKA HLYQEILQPS AEYLGSLLGV    960
DKWAVEIFTE EIIRAGSAAS LSTLLNRLDP VLRKTAHLGS WQVISPVETV GYVEVVDELL    1020
TVQNKSYERP TILIANSVKG EEEIPDGTVA VLTPDMPDVL SHVSVRARNS KVCFATCFDP    1080
NILANLQEYK GKLLRLKPTS ADVVYSEVKE GEFIDDKSTQ LKDVGSVSPI SLARKKFSGR    1140
YAVSSEEFTG EMVGAKSRNI SYLKGKVASW IGIPTSVAIP FGVFEHVLSD KPNQAVAERV    1200
NNLKKKLTEG DFSVLKEIRE TVLQLNAPSQ LVEELKTKMK SSGMPWPGDE GEQRWEQAWI    1260
AIKKVWGSKW NERAYFSTRK VKLDHEYLSM AVLVQEVINA DYAFVIHTTN PASGDSSEIY    1320
AEVVKGLGET LVGAYPGRAL SFICKKRDLN SPQVLGYPSK PVGLFIRQSI IFRSDSNGED    1380
LEGYAGAGLY DSVPMDEAEK VVLDYSSDKL ILDGSFRQSI LSSIARAGNE IEELYGTPQD    1440
IEGVIKDGKV YVVQTRPQM*                                                1500
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02784PLN027846.0e-9424533114+
PLN02784PLN027841.0e-10121294198+
PRK06464PRK064642.0e-1312611457212+
TIGR01418PEP_synth2.0e-1412611458208+
pfam01326PPDK_N3.0e-3311491458334+
Gene Ontology
GO TermDescription
GO:0005524ATP binding
GO:0016301kinase activity
GO:0016310phosphorylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAK11735.101145951464starch associated protein R1 [Solanum tuberosum]
Swiss-ProtQ8LPT901145951475GWD1_CITRE RecName: Full=Alpha-glucan water dikinase, chloroplastic; AltName: Full=Starch-related protein R1; Flags: Precursor
RefSeqXP_002270485.101145951470PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002315679.1051459131477predicted protein [Populus trichocarpa]
RefSeqXP_002527902.101145911469alpha-glucan water dikinase, chloroplast precursor, putative [Ricinus communis]
Metabolic Pathways
Pathway NameReactionECProtein Name
starch degradation IIRXN-12203EC-2.7.9.4α-glucan, water dikinase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO77752389856314600
HO79439875171014600
HO7943981415687080
HO7799573441915340
HO779957606036620
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00059.2.125.200Aquca_002_00059.2.125.200Aquca_002_00059.1.125.200Aquca_002_00059.1.125.200Aquca_010_00076.4
Aquca_010_00076.3Aquca_010_00076.2Aquca_010_00076.1Aquca_002_00499.4.322.398Aquca_002_00499.4.322.398
Aquca_002_00499.3.322.398Aquca_002_00499.3.322.398Aquca_002_00499.2.322.398Aquca_002_00499.2.322.398Aquca_002_00499.1.322.398
Aquca_002_00499.1.322.398Aquca_002_00059.3Aquca_002_00059.2.379.458Aquca_002_00059.2.379.458Aquca_002_00059.1.379.458
Aquca_002_00059.1.379.458Aquca_002_00499.4.126.212Aquca_002_00499.4.126.212Aquca_002_00499.3.126.212Aquca_002_00499.3.126.212
Aquca_002_00499.2.126.212Aquca_002_00499.2.126.212Aquca_002_00499.1.126.212Aquca_002_00499.1.126.212
Arabidopsis lyrata888368.117.192888368.117.192339218.127.210888368.391.469888368.391.469
492401
Arabidopsis thalianaAT1G10760.1.120.195AT1G10760.1.120.195AT1G69830.1.305.381AT1G69830.1.305.381AT1G69830.1.126.209
AT1G69830.1.126.209AT1G10760.1.394.472AT1G10760.1.394.472AT4G24450.1
Brachypodium distachyonBradi1g41907.2.109.184Bradi1g41907.2.109.184Bradi1g41907.1.109.184Bradi1g41907.1.109.184Bradi3g11270.1
Bradi2g48150.1.119.204Bradi2g48150.1.119.204Bradi1g41907.2.447.524Bradi1g41907.2.447.524Bradi1g41907.1.447.524
Bradi1g41907.1.447.524Bradi2g48150.1.299.375Bradi2g48150.1.299.375
Brassica rapaBra031749Bra018423.116.191Bra018423.116.191Bra016262.314.390Bra016262.314.390
Bra016262.127.210Bra016262.127.210Bra018423.389.467Bra018423.389.467Bra013803
Carica papayaevm.model.supercontig_69.90evm.model.supercontig_5.271.119.202
Capsella rubellaCarubv10008131mCarubv10019759m.318.394Carubv10019759m.318.394Carubv10019759m.133.214Carubv10019759m.133.214
Carubv10006877m
Citrus clementinaCiclev10030521mCiclev10030520mCiclev10030501mCiclev10030500mCiclev10030499m
Ciclev10030780m.171.247Ciclev10030661m.319.395Ciclev10030661m.319.395Ciclev10017434mCiclev10030661m.128.211
Ciclev10030661m.128.211
Citrus sinensisorange1.1g006158m.75.151orange1.1g004353m.317.393orange1.1g004353m.317.393orange1.1g003698m.219.295orange1.1g003698m.219.295
orange1.1g003613m.317.393orange1.1g003613m.317.393orange1.1g003004m.317.393orange1.1g003004m.317.393orange1.1g002611m.317.393
orange1.1g002611m.317.393orange1.1g002585m.317.393orange1.1g002585m.317.393orange1.1g001903morange1.1g001677m
orange1.1g001333morange1.1g001268morange1.1g001019morange1.1g004353m.126.209orange1.1g004353m.126.209
orange1.1g003698m.28.111orange1.1g003698m.28.111orange1.1g003613m.126.209orange1.1g003613m.126.209orange1.1g003004m.126.209
orange1.1g003004m.126.209orange1.1g002611m.126.209orange1.1g002611m.126.209orange1.1g002585m.126.209orange1.1g002585m.126.209
Cucumis sativusCucsa.286300.3Cucsa.286300.2Cucsa.286300.1Cucsa.285330.2.172.248Cucsa.285330.1.312.388
Cucsa.285330.1.312.388Cucsa.285330.1.120.205Cucsa.285330.1.120.205
Eucalyptus grandisEucgr.H02531.2.128.203Eucgr.H02531.2.128.203Eucgr.H02531.1.128.203Eucgr.H02531.1.128.203Eucgr.G02543.2.332.409
Eucgr.G02543.2.332.409Eucgr.G02543.1.332.409Eucgr.G02543.1.332.409Eucgr.H02531.2.459.539Eucgr.H02531.2.459.539
Eucgr.H02531.1.459.539Eucgr.H02531.1.459.539Eucgr.G02543.2.138.224Eucgr.G02543.2.138.224Eucgr.G02543.1.138.224
Eucgr.G02543.1.138.224
Fragaria vescamrna03581.1-v1.0-hybrid
Glycine maxGlyma08g39110.2.123.198Glyma08g39110.2.123.198Glyma08g39110.1.123.198Glyma08g39110.1.123.198Glyma18g20600.2.123.198
Glyma18g20600.2.123.198Glyma02g02450.1.313.389Glyma02g02450.1.313.389Glyma08g39110.2.452.531Glyma08g39110.2.452.531
Glyma08g39110.1.452.531Glyma08g39110.1.452.531Glyma18g20600.2.452.531Glyma18g20600.2.452.531Glyma08g40810.1.133.219
Glyma08g40810.1.133.219Glyma08g40810.1.327.403Glyma08g40810.1.327.403Glyma04g10375.2Glyma04g10375.1
Glyma02g02450.1.120.206Glyma02g02450.1.120.206
Gossypium raimondiiGorai.002G186200.7.135.210Gorai.002G186200.7.135.210Gorai.002G186200.6.121.196Gorai.002G186200.6.121.196Gorai.002G186200.5.135.210
Gorai.002G186200.5.135.210Gorai.002G186200.4.135.210Gorai.002G186200.4.135.210Gorai.002G186200.3.135.210Gorai.002G186200.3.135.210
Gorai.002G186200.2.135.210Gorai.002G186200.2.135.210Gorai.002G186200.1.136.211Gorai.002G186200.1.136.211Gorai.008G160400.2
Gorai.008G160400.1Gorai.002G186200.8Gorai.002G186200.7.465.544Gorai.002G186200.7.465.544Gorai.002G186200.6.451.530
Gorai.002G186200.6.451.530Gorai.002G186200.5.465.544Gorai.002G186200.5.465.544Gorai.002G186200.4.465.544Gorai.002G186200.4.465.544
Gorai.002G186200.3.465.544Gorai.002G186200.3.465.544Gorai.002G186200.2.465.544Gorai.002G186200.2.465.544Gorai.002G186200.1.466.545
Gorai.002G186200.1.466.545Gorai.008G182600.7Gorai.008G182600.6.125.208Gorai.008G182600.5.125.208Gorai.008G182600.4.125.208
Gorai.008G182600.3.123.206Gorai.008G182600.2.125.208Gorai.008G182600.1.125.208
Linum usitatissimumLus10013044.135.210Lus10013044.135.210Lus10029118.135.210Lus10029118.135.210Lus10036717.126.209
Lus10036717.126.209Lus10030793.133.216Lus10030793.133.216Lus10013270.136.219Lus10013270.136.219
Lus10037211.126.209Lus10037211.126.209Lus10030793.315.391Lus10030793.315.391Lus10013270.318.394
Lus10013270.318.394Lus10037211.305.381Lus10037211.305.381Lus10036717.305.381Lus10036717.305.381
Lus10029118.445.523Lus10029118.445.523Lus10013044.463.541Lus10013044.463.541Lus10032829
Malus domesticaMDP0000252405.192.267MDP0000252405.192.267MDP0000951961.54.127MDP0000951961.54.127MDP0000951961.323.402
MDP0000951961.323.402MDP0000252405.478.557MDP0000252405.478.557
Manihot esculentacassava4.1_000266m.133.208cassava4.1_000266m.133.208cassava4.1_004613m.310.386cassava4.1_004613m.310.386cassava4.1_000266m.404.482
cassava4.1_000266m.404.482cassava4.1_004613m.121.204cassava4.1_004613m.121.204cassava4.1_001555m.120.203cassava4.1_001362m.120.203
Mimulus guttatusmgv1a000186mmgv1a000185mmgv1a001104m.306.382mgv1a001104m.306.382mgv1a001104m.125.211
mgv1a001104m.125.211
Oryza sativaLOC_Os01g51754.4LOC_Os01g51754.3
Panicum virgatumPavirv00036852m.113.188Pavirv00036852m.113.188Pavirv00030888m.120.203Pavirv00030888m.120.203Pavirv00061832m.120.203
Pavirv00061832m.120.203Pavirv00036852m.456.533Pavirv00036852m.456.533Pavirv00061832m.304.382Pavirv00061832m.304.382
Pavirv00030888m.304.382Pavirv00030888m.304.382
Phaseolus vulgarisPhvul.003G062900.1.120.195Phvul.003G062900.1.120.195Phvul.002G065700.1.313.389Phvul.002G065700.1.313.389Phvul.003G062900.1.449.528
Phvul.003G062900.1.449.528Phvul.003G069200.1.132.218Phvul.003G069200.1.132.218Phvul.003G069200.1.326.402Phvul.003G069200.1.326.402
Phvul.002G065700.1.119.205Phvul.002G065700.1.119.205
Picea abiesMA_50250g0010MA_108710g0010MA_72129g0020
Populus trichocarpaPotri.010G044100.4.130.205Potri.010G044100.4.130.205Potri.010G044100.3Potri.010G044100.2Potri.010G044100.1
Potri.008G188200.2Potri.008G188200.1Potri.010G092900.9.140.223Potri.010G092900.9.140.223Potri.010G092900.8.140.223
Potri.010G092900.8.140.223Potri.010G092900.6.140.223Potri.010G092900.6.140.223Potri.010G092900.5.140.223Potri.010G092900.5.140.223
Potri.010G092900.4.140.223Potri.010G092900.4.140.223Potri.010G092900.3.140.223Potri.010G092900.3.140.223Potri.010G092900.2.140.223
Potri.010G092900.2.140.223Potri.010G092900.1.140.223Potri.010G092900.1.140.223Potri.010G092900.9.331.407Potri.010G092900.9.331.407
Potri.010G092900.8.331.407Potri.010G092900.8.331.407Potri.010G092900.6.331.407Potri.010G092900.6.331.407Potri.010G092900.5.320.396
Potri.010G092900.5.320.396Potri.010G092900.4.316.392Potri.010G092900.4.316.392Potri.010G092900.3.331.407Potri.010G092900.3.331.407
Potri.010G092900.2.327.403Potri.010G092900.2.327.403Potri.010G092900.1.331.407Potri.010G092900.1.331.407Potri.010G044100.4.469.548
Potri.010G044100.4.469.548
Prunus persicappa000209m.127.202ppa000209m.127.202ppa001575m.213.289ppa000209m.462.540ppa000209m.462.540
Ricinus communis27504.m000617.131.20627504.m000617.131.20629736.m002033.124.20729736.m002033.124.20729736.m002033.313.389
29736.m002033.313.38927504.m000617.462.54127504.m000617.462.541
Setaria italicaSi005690m.113.188Si005690m.113.188Si000308m.120.203Si000308m.120.203Si000258m.120.203
Si000258m.120.203Si005690m.456.533Si005690m.456.533Si000308m.304.382Si000308m.304.382
Si000258m.304.382Si000258m.304.382
Sorghum bicolorSb10g017820.1.117.192Sb10g017820.1.117.192Sb03g032830.1.58.143Sb03g032830.1.58.143Sb10g017820.1.460.537
Sb10g017820.1.460.537Sb03g032830.1.241.319Sb03g032830.1.241.319
Thellungiella halophilaThhalv10006578mThhalv10006565mThhalv10018099m.133.216Thhalv10018099m.133.216Thhalv10018099m.318.394
Thhalv10018099m.318.394Thhalv10024230m
Vitis viniferaGSVIVT01013806001GSVIVT01020069001.305.381GSVIVT01020069001.305.381GSVIVT01020069001.117.203GSVIVT01020069001.117.203
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)