y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma18g20856.1
FamilyGT77
Protein PropertiesLength: 314 Molecular Weight: 35786.3 Isoelectric Point: 8.4425
ChromosomeChromosome/Scaffold: 18 Start: 23529062 End: 23531137
DescriptionNucleotide-diphospho-sugar transferase family protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT771853111.5e-30
  IENFIVYALDKETYQFSILQGIPVFTDPIAPSNVSFDDCHFGTKCFQRVTKVKSRIVLKILKLGYNVLLSDVDVYWFKNPVPLLHSFGPAVLAVHFKSIV
  ICAGPINLPRRLNSSFYYAHSNIQTIA
Full Sequence
Protein Sequence     Length: 314     Download
MKDLVKEEKQ TCMIFGVLPP FLYGKGTHNN WQIHEAMSSE FRFVFDASLT ITSFYLNDED    60
DLSPTHGNSS AVHVENRSWE YIGNSHIGAN YGSFFYSEAN FSSLVQLFKC QKQYVMVDTK    120
KNIVYPIGHQ GSMNLMKEKV FPSWLKENTV YCIDHKTKTV ILTIAGYSYK DMLMSWVCRL    180
QKLSIENFIV YALDKETYQF SILQGIPVFT DPIAPSNVSF DDCHFGTKCF QRVTKVKSRI    240
VLKILKLGYN VLLSDVDVYW FKNPVPLLHS FGPAVLAVHF KSIVICAGPI NLPRRLNSSF    300
YYAHSNIQTI AAI*                                                      360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03407Nucleotid_trans2.0e-28185311128+
Gene Ontology
GO TermDescription
GO:0005783endoplasmic reticulum
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN65937.1016313100424hypothetical protein [Vitis vinifera]
RefSeqNP_177220.2016313108427unknown protein [Arabidopsis thaliana]
RefSeqXP_002271910.1016313107441PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002312675.1016313107440predicted protein [Populus trichocarpa]
RefSeqXP_002527929.1016276182479conserved hypothetical protein [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX136364291403130
GE580294252993130
EX1364522271033130
EH6740231561583130
EE605871250822940
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_094_00019.1Aquca_094_00019.2Aquca_094_00019.3Aquca_094_00019.4
Arabidopsis lyrata476193
Arabidopsis thalianaAT1G70630.1
Brachypodium distachyonBradi2g19997.1
Brassica rapaBra016198
Carica papayaevm.model.supercontig_33.19
Capsella rubellaCarubv10019952mCarubv10020113m
Citrus clementinaCiclev10033870m
Citrus sinensisorange1.1g043225m
Cucumis sativusCucsa.286480.1
Eucalyptus grandisEucgr.B03287.1
Glycine maxGlyma08g38866.1
Gossypium raimondiiGorai.005G178600.1Gorai.005G178600.2
Linum usitatissimumLus10036860Lus10006212
Malus domesticaMDP0000300726
Manihot esculentacassava4.1_024537m
Medicago truncatulaMedtr8g069400.1
Mimulus guttatusmgv1a025056mmgv1a022943m
Oryza sativaLOC_Os05g43810.1
Panicum virgatumPavirv00043566mPavirv00008500m
Physcomitrella patensPp1s151_80V6.1Pp1s21_134V6.1
Phaseolus vulgarisPhvul.003G065100.1
Picea abiesMA_10426353g0010
Populus trichocarpaPotri.008G186800.1
Prunus persicappa019665m
Ricinus communis27504.m000645
Selaginella moellendorffii76356
Sorghum bicolorSb09g025390.1
Thellungiella halophilaThhalv10018343m
Vitis viniferaGSVIVT01005754001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny