y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma18g32840.1
FamilyCBM43
Protein PropertiesLength: 468 Molecular Weight: 51703.5 Isoelectric Point: 9.8448
ChromosomeChromosome/Scaffold: 18 Start: 38273414 End: 38276451
DescriptionO-Glycosyl hydrolases family 17 protein
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CBM433784612e-27
  WCVAARRDNATALTAALAYACSQGNGTCDPIQSKGKCFKPDSVFWHASYAFSAYWAQFRKVGGTCYFNGLATQTAKDPSYGSCK
GH17303510
  GICYGQLGDNLPPPRESVSLITSVHAKRVKLYDANPSILHALQDTRLQVSIMVPNDLILNISTNQTLSDQWVSDNVVPYHPRTLIRYLLVGNEVTSTTAA
  TATWPHLVPAMRRIKRSLKSHGIRKIKVGTSSAMDVLQTSFPPSNGAFRKDLTAPVMKPMLKFLNRTKSFFFLDVYPFFTWSADPLNINLDYALFESKTV
  TVKDPVSGLVYTNLFDQMVDAVYFAMKRLGFPGVRIFIAETGWPNGGDLDQIGANTYNAATYNRNFIKKVTKKPRVGTPARPGSALPSFLFALFNENQKP
  GPSTERHFGLLHPNGSRVYDVD
Full Sequence
Protein Sequence     Length: 468     Download
MAMLLLIPLF LSSILLFPIS SATTFSPQPG ICYGQLGDNL PPPRESVSLI TSVHAKRVKL    60
YDANPSILHA LQDTRLQVSI MVPNDLILNI STNQTLSDQW VSDNVVPYHP RTLIRYLLVG    120
NEVTSTTAAT ATWPHLVPAM RRIKRSLKSH GIRKIKVGTS SAMDVLQTSF PPSNGAFRKD    180
LTAPVMKPML KFLNRTKSFF FLDVYPFFTW SADPLNINLD YALFESKTVT VKDPVSGLVY    240
TNLFDQMVDA VYFAMKRLGF PGVRIFIAET GWPNGGDLDQ IGANTYNAAT YNRNFIKKVT    300
KKPRVGTPAR PGSALPSFLF ALFNENQKPG PSTERHFGLL HPNGSRVYDV DLSGETPEAE    360
FRPLPVPENN EKFKGRIWCV AARRDNATAL TAALAYACSQ GNGTCDPIQS KGKCFKPDSV    420
FWHASYAFSA YWAQFRKVGG TCYFNGLATQ TAKDPSYGSC KFPSVTL*                 480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03198Glyco_hydro_720.00312016546+
pfam07983X82.0e-1137844981+
smart00768X83.0e-2837846285+
pfam00332Glyco_hydro_171.0e-10930351323+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM65039.102146717460putative glucan endo-1-3-beta-glucosidase [Arabidopsis thaliana]
EMBLCBI39470.10946711467unnamed protein product [Vitis vinifera]
RefSeqNP_683538.102146717460glycosyl hydrolase family 17 protein [Arabidopsis thaliana]
RefSeqXP_002303070.101546710461predicted protein [Populus trichocarpa]
RefSeqXP_002334812.1014671465predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2cyg_A0303522312A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_D0303533316A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_C0303533316A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_B0303533316A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
PDB3f55_A0303533316A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX2913573601014580
EX2795003151044170
DY302831317593740
EX279500194214390.069
EX279500144084210.069
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_034_00089.1.396.481Aquca_009_00879.1.376.461
Arabidopsis lyrata317589.371.454479892.387.470493503.389.472
Arabidopsis thalianaAT3G07320.1.371.454AT3G23770.1.387.470AT4G14080.1.389.472
Brachypodium distachyonBradi3g40907.1.397.480Bradi3g40907.1.397.480Bradi4g34390.1.385.471Bradi5g12137.1.382.465Bradi3g40907.1.501.584
Bradi3g40907.1.501.584
Brassica rapaBra001918.391.473Bra028343.387.470Bra037057.390.473Bra014979.389.472Bra001245.371.450
Bra032758.391.474Bra029639.371.454Bra038969.390.468
Carica papayaevm.model.supercontig_8.110.373.456evm.model.supercontig_157.32.380.459
Capsella rubellaCarubv10006945m.389.472Carubv10015952m.387.470Carubv10013655m.371.454
Citrus clementinaCiclev10031440m.377.460Ciclev10004917m.379.458
Citrus sinensisorange1.1g012660m.379.457
Cucumis sativusCucsa.251950.1.378.460Cucsa.149990.1.374.457
Eucalyptus grandisEucgr.K02113.2.377.460Eucgr.K02113.1.377.460Eucgr.H02646.1.352.434
Fragaria vescamrna17437.1-v1.0-hybrid.483.561mrna17436.1-v1.0-hybrid.347.425
Glycine maxGlyma18g32840.1.378.461Glyma08g46110.1.378.461
Gossypium raimondiiGorai.005G026800.1.373.456Gorai.001G230200.2.372.451Gorai.006G224700.1.373.456Gorai.001G230200.3.297.380Gorai.001G230200.1.372.455
Gorai.N004800.1.375.458
Linum usitatissimumLus10008881.379.462Lus10023226.358.441Lus10001740Lus10025892.333.417Lus10038211.374.458
Malus domesticaMDP0000317729.374.452MDP0000283768.334.416MDP0000235663.374.452
Manihot esculentacassava4.1_023781m.375.458cassava4.1_024973m.361.439cassava4.1_007070m.376.459
Medicago truncatulaMedtr8g012400.1.374.457
Mimulus guttatusmgv1a005774m.382.465mgv1a006049m.370.453
Oryza sativaLOC_Os09g32550.2.384.471LOC_Os09g32550.1.387.474LOC_Os03g62860.1.382.467LOC_Os08g41410.1.385.467
Panicum virgatumPavirv00066351m.389.471Pavirv00044843m.360.447Pavirv00008164m.395.481Pavirv00006057m.374.460Pavirv00059046m.386.467
Phaseolus vulgarisPhvul.010G023800.1.372.455Phvul.008G142200.1.376.459
Picea abiesMA_907g0010MA_2025g0010.240.322MA_10426132g0010.130.212MA_10434158g0010.296.378MA_228746g0010.274.356
Populus trichocarpaPotri.002G247900.2.376.454Potri.002G247900.1.376.459Potri.002G247800.1.376.459Potri.017G060300.1.377.460Potri.001G321900.1.327.410
Prunus persicappa006984m.298.381ppa016789m.361.446
Ricinus communis28401.m000073.298.381
Setaria italicaSi029669m.389.476Si015679m.397.484
Selaginella moellendorffii85067.362.443
Sorghum bicolorSb01g001430.1.390.476Sb02g029080.1.388.475Sb07g026540.1.393.478
Thellungiella halophilaThhalv10002513m.385.468Thhalv10025081m.390.473Thhalv10020660m.380.463Thhalv10020663m.380.463
Vitis viniferaGSVIVT01031619001.286.369GSVIVT01031698001.378.461
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)