y PlantCAZyme

CAZyme Information

Basic Information
SpeciesGlycine max
Cazyme IDGlyma18g35720.1
FamilyGH16
Protein PropertiesLength: 290 Molecular Weight: 33948.3 Isoelectric Point: 8.9054
ChromosomeChromosome/Scaffold: 18 Start: 41960927 End: 41963643
Descriptionxyloglucan endotransglucosylase/hydrolase 2
View CDS
External Links
NCBI Taxonomy
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH16562136.1e-26
  QLSIDKTSGAGFRSKLEYASGFFQMRIKIPNKDCRGVVTAFYLTSTAYKHLGAKHDEIDFEFLGNNGQPHTLQTNVFTNDEGGREQRHSLWFDPTIIFHT
  YGVLWNQHQIVFYVDEIPIRVFKNYSNVGVSFPSQQMHVTASIWNGEPWASNGKRIDW
Full Sequence
Protein Sequence     Length: 290     Download
MAQLQKQQNF CFVLLLFVAL GIAYAREAFE VSFQQNYKIA WGKHHIFFLQ HGREVQLSID    60
KTSGAGFRSK LEYASGFFQM RIKIPNKDCR GVVTAFYLTS TAYKHLGAKH DEIDFEFLGN    120
NGQPHTLQTN VFTNDEGGRE QRHSLWFDPT IIFHTYGVLW NQHQIVFYVD EIPIRVFKNY    180
SNVGVSFPSQ QMHVTASIWN GEPWASNGKR IDWKQAPFTA QFQGFNIHGC QTQNYNKHAC    240
YSPYLWWNDK KHWKLNSQQQ RAYEDVRKKH LLYDYCSDRG ELHKECQIN*               300
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd02175GH16_lichenase3.0e-2140203172+
cd02183GH16_fungal_CRH1_transglycosylase2.0e-2290236162+
pfam00722Glyco_hydro_165.0e-6433214185+
PLN03161PLN031613.0e-761286297+
cd02176GH16_XET5.0e-12331286264+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005618cell wall
GO:0005975carbohydrate metabolic process
GO:0006073cellular glucan metabolic process
GO:0016762xyloglucan:xyloglucosyl transferase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU19906.10802891210unknown [Glycine max]
EMBLCAN73201.103028632288hypothetical protein [Vitis vinifera]
RefSeqXP_002266811.103028624278PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002301792.10212793260predicted protein [Populus trichocarpa]
RefSeqXP_002521076.10112797273Xyloglucan endotransglucosylase/hydrolase protein 2 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1un1_B0212875273A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB1un1_A0212875273A Chain A, Characterization And Engineering Of The Bifunctional N- And O-glucosyltransferase Involved In Xenobiotic Metabolism In Plants
PDB1umz_B0212875273A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg.
PDB1umz_A0212875273A Chain A, Xyloglucan Endotransglycosylase In Complex With The Xyloglucan Nonasaccharide Xllg.
PDB2uwb_B03028617267A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
Transmembrane Domains
StartEnd
1229
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO980946193982900
EV271080157672230
EV271080577630
CO116549275132790
ES827892288132890
Orthologous Group
SpeciesID
Arabidopsis lyrata884593899104485216359038359039
883627883616
Arabidopsis thalianaAT4G13090.1AT3G25050.1AT3G48580.1AT4G13080.1
Brachypodium distachyonBradi1g44777.1Bradi1g71937.1
Brassica rapaBra001434Bra015093Bra001433
Carica papayaevm.model.supercontig_8.136
Capsella rubellaCarubv10016385mCarubv10005358mCarubv10006916mCarubv10006944mCarubv10018461m
Citrus clementinaCiclev10033360mCiclev10023425m
Citrus sinensisorange1.1g042925morange1.1g041460m
Cucumis sativusCucsa.067150.1
Eucalyptus grandisEucgr.H00787.1Eucgr.H00788.1Eucgr.K02717.1Eucgr.K02715.1
Fragaria vescamrna17598.1-v1.0-hybrid
Glycine maxGlyma18g35720.2Glyma08g46450.1
Gossypium raimondiiGorai.007G155700.1Gorai.004G226400.1
Linum usitatissimumLus10032879Lus10025919Lus10038182Lus10022784Lus10011845
Lus10022782
Malus domesticaMDP0000311020
Manihot esculentacassava4.1_032567m
Medicago truncatulaMedtr2g049030.1Medtr2g049130.1
Mimulus guttatusmgv1a010995mmgv1a011712mmgv1a020473mmgv1a011649mmgv1a025665m
mgv1a019895mmgv1a020281mmgv1a021895mmgv1a011700mmgv1a010970m
Oryza sativaLOC_Os06g13040.1
Panicum virgatumPavirv00069636mPavirv00044296mPavirv00046059m
Phaseolus vulgarisPhvul.008G129900.1Phvul.008G129100.1
Picea abiesMA_300041g0010MA_10083496g0010MA_254951g0010
Populus trichocarpaPotri.002G244200.1
Prunus persicappa019741mppa027154m
Ricinus communis30204.m00174129904.m002924
Setaria italicaSi007117mSi006999m
Selaginella moellendorffii403283
Sorghum bicolorSb10g008540.1Sb10g008550.1
Thellungiella halophilaThhalv10002629mThhalv10010620mThhalv10026812m
Vitis viniferaGSVIVT01003280001GSVIVT01004746001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny